Gastrotropin/FABP6, Human (His)
Gastrotropin/FABP6 is a fatty acid binding protein, or ileal bile acid binding protein (IBABP) . FABP6 is a therapeutic target related to immune infiltration, and FABP6 inhibition inhibits cancer cell proliferation and migration. Gastrotropin/FABP6 Protein, Human (His) is the recombinant human-derived Gastrotropin/FABP6 protein, expressed by E. coli , with N-6*His labeled tag.
Product Specifications
Product Name Alternative
Gastrotropin/FABP6 Protein, Human (His), Human, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/gastrotropin-fabp6-protein-human-his.html
Smiles
MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
Molecular Formula
2172 (Gene_ID) AAH22489.1 (M1-A128) (Accession)
Molecular Weight
Approximately 15 kDa, based on SDS-PAGE under reducing conditions.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
CD44 Standard (156-3C11), CF568 conjugate, 0.1mg/mL
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
TACSTD2 / TROP2 (Epithelial Marker) (TACSTD2/2152), CF594 conjugate, 0.1mg/mL
