Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Uteroglobin/SCGB1A1, Mouse (HEK293, His)

Uteroglobin/SCGB1A1 protein has multiple binding abilities and can interact with phosphatidylcholine, phosphatidylinositol, PCB, and binds weakly to progesterone.As a potent phospholipase A2 inhibitor, its antiparallel homodimer structure is maintained by disulfide bonds.Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Uteroglobin/SCGB1A1 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Uteroglobin/SCGB1A1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/scgb1a1-protein-mouse-hek-293-his.html

Purity

95.0

Smiles

DICPGFLQVLEALLMESESGYVASLKPFNPGSDLQNAGTQLKRLVDTLPQETRINIMKLTEKILTSPLCKQDLRF

Molecular Formula

22287 (Gene_ID) Q06318 (D22-F96) (Accession)

Molecular Weight

Approximately 9.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

V-type Proton ATPase Subunit G 1, Recombinant, Human, aa2-118, GST-Tag
586758-01 20 µg

V-type Proton ATPase Subunit G 1, Recombinant, Human, aa2-118, GST-Tag

Sign In for Pricing
View Details
V-type Proton ATPase Subunit G 1, Recombinant, Human, aa2-118, GST-Tag
586758-02 100 µg

V-type Proton ATPase Subunit G 1, Recombinant, Human, aa2-118, GST-Tag

Sign In for Pricing
View Details
PNKP Polyclonal Antibody
E44H07670 100 µL

PNKP Polyclonal Antibody

Sign In for Pricing
View Details
Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®488A Conjugate
81-4001 1 mL

Lycopersicon Esculentum (Tomato) Lectin (LEL, TL), CF®488A Conjugate

Sign In for Pricing
View Details
Pro-Epidermal Growth Factor (EGF) Antibody
abx170809-01 100 µL

Pro-Epidermal Growth Factor (EGF) Antibody

Sign In for Pricing
View Details
Pro-Epidermal Growth Factor (EGF) Antibody
abx170809-02 200 µL

Pro-Epidermal Growth Factor (EGF) Antibody

Sign In for Pricing
View Details