Hirudin, Poecilobdella viridis (P. pastoris)
Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free.
Product Specifications
Product Name Alternative
Hirudin Protein, Poecilobdella viridis (P. pastoris), Others, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/hirudin-protein-p-pastoris.html
Purity
97.25
Smiles
VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL
Molecular Formula
/ (Gene_ID) P84590 (V1-L63) (Accession)
Molecular Weight
Approximately 6.7 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Browse additional items from our catalog
IL12RB1 (Interleukin-12 Receptor Subunit beta-1, IL-12 Receptor Subunit beta-1, IL-12R Subunit beta-1, IL-12R-beta-1, IL-12RB1, IL-12 Receptor beta Component, CD212, IL12R, IL12RB, MGC34454) (FITC)
IL12RB1 (Interleukin-12 Receptor Subunit beta-1, IL-12 Receptor Subunit beta-1, IL-12R Subunit beta-1, IL-12R-beta-1, IL-12RB1, IL-12 Receptor beta Component, CD212, IL12R, IL12RB, MGC34454) (FITC)
Interferon Regulatory Factor 3 (IRF3, IRF-3) (MaxLight 490) discontinued