Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hirudin, Poecilobdella viridis (P. pastoris)

Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free.

Product Specifications

Product Name Alternative

Hirudin Protein, Poecilobdella viridis (P. pastoris), Others, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hirudin-protein-p-pastoris.html

Purity

97.25

Smiles

VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL

Molecular Formula

/ (Gene_ID) P84590 (V1-L63) (Accession)

Molecular Weight

Approximately 6.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Parp1 Mouse Gene Knockout Kit (CRISPR)
KN512819 1 Kit

Parp1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lentiviral human DUSP10 shRNA (UAS) - Lentiviral human DUSP10 shRNA (UAS) (25)
GTR15139097 1 Vial

Lentiviral human DUSP10 shRNA (UAS) - Lentiviral human DUSP10 shRNA (UAS) (25)

Sign In for Pricing
View Details
NSMAF (NM_001144772) Human Tagged Lenti ORF Clone
RC227565L4 10 µg

NSMAF (NM_001144772) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Protein Delta Homolog 2 (DLK2) ELISA Kit
abx389034 96 Tests

Mouse Protein Delta Homolog 2 (DLK2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human SRRM5 Protein
E30P12387 20 µg

Recombinant Human SRRM5 Protein

Sign In for Pricing
View Details
Rabbit Polyclonal PACSIN1 Antibody [Alexa Fluor 594]
NBP2-99230AF594 0.1 mL

Rabbit Polyclonal PACSIN1 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details