Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hirudin, Poecilobdella viridis (P. pastoris)

Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free.

Product Specifications

Product Name Alternative

Hirudin Protein, Poecilobdella viridis (P. pastoris), Others, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hirudin-protein-p-pastoris.html

Purity

97.25

Smiles

VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL

Molecular Formula

/ (Gene_ID) P84590 (V1-L63) (Accession)

Molecular Weight

Approximately 6.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL28B CRISPRa sgRNA lentivector (set of three targets)(Mouse)
24875124 3x 1.0µg DNA

IL28B CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Recombinant Human TGF beta 1 protein (His Tag)
PKSH034147-01 20 µg

Recombinant Human TGF beta 1 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human TGF beta 1 protein (His Tag)
PKSH034147-02 100 µg

Recombinant Human TGF beta 1 protein (His Tag)

Sign In for Pricing
View Details
TCTN2 (NM_024809) Human Tagged ORF Clone Lentiviral Particle
RC203860L3V 200 µL

TCTN2 (NM_024809) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rat Sqle Pre-designed siRNA Set A
SI213732A 1 Each

Rat Sqle Pre-designed siRNA Set A

Sign In for Pricing
View Details
SNORD114-7 ORF Vector (Human) (pORF)
44728011 1.0 µg DNA

SNORD114-7 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details