Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hirudin, Poecilobdella viridis (P. pastoris)

Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free.

Product Specifications

Product Name Alternative

Hirudin Protein, Poecilobdella viridis (P. pastoris), Others, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hirudin-protein-p-pastoris.html

Purity

97.25

Smiles

VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL

Molecular Formula

/ (Gene_ID) P84590 (V1-L63) (Accession)

Molecular Weight

Approximately 6.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Putative double homeobox protein 3, DUX3 ELISA KIT
ELI-27705h 96 Tests

Human Putative double homeobox protein 3, DUX3 ELISA KIT

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1039791-01 0.02 mg (E-Coli)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1039791-02 0.02 mg (Yeast)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1039791-03 0.1 mg (E-Coli)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1039791-04 0.1 mg (Yeast)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details
Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)
MBS1039791-05 0.02 mg (Baculovirus)

Recombinant Xanthomonas oryzae pv. oryzae Phosphoribosylglycinamide formyltransferase 2 (purT)

Sign In for Pricing
View Details