Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hirudin, Poecilobdella viridis (P. pastoris)

Hirudin Protein, a powerful thrombin-specific protease inhibitor, forms a stable non-covalent complex with alpha-thrombin, effectively preventing fibrinogen cleavage. This interaction underscores hirudin's critical role in regulating key coagulation cascade steps. Its specific thrombin inhibition emphasizes hirudin's significance as a therapeutic agent, particularly for precise blood clotting regulation. Hirudin Protein, Poecilobdella viridis (P. pastoris) is the recombinant Hirudin protein, expressed by P. pastoris , with tag free.

Product Specifications

Product Name Alternative

Hirudin Protein, Poecilobdella viridis (P. pastoris), Others, P. pastoris

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hirudin-protein-p-pastoris.html

Purity

97.25

Smiles

VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEPEEYL

Molecular Formula

/ (Gene_ID) P84590 (V1-L63) (Accession)

Molecular Weight

Approximately 6.7 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Cytochrome p450 2J2 Antibody (OTI5C9) [Alexa Fluor 350]
NBP2-70533AF350 0.1 mL

Mouse Monoclonal Cytochrome p450 2J2 Antibody (OTI5C9) [Alexa Fluor 350]

Sign In for Pricing
View Details
Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit
MBS2021631-01 24 Strip Well

Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit

Sign In for Pricing
View Details
Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit
MBS2021631-02 48 Strip Well

Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit

Sign In for Pricing
View Details
Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit
MBS2021631-03 96 Strip Well

Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit

Sign In for Pricing
View Details
Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit
MBS2021631-04 5x 96 Strip Well

Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit

Sign In for Pricing
View Details
Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit
MBS2021631-05 10x 96 Strip Well

Rat Diacylglycerol-O-Acyltransferase Homolog 1 (DGAT1) ELISA Kit

Sign In for Pricing
View Details