Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD28, Human/Cynomolgus/Rhesus Macaque (HEK293)

The CD28 protein is critical for T cell activation, enhancing proliferation, cytokine production, and survival. When linked to TCR/CD3 and CD40L, CD28 promotes the production of IL4 and IL10, thereby regulating immune responses. CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293) is the recombinant human-derived CD28 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

CD28 Protein, Human/Cynomolgus/Rhesus Macaque (HEK293), Rhesus Macaque; Human; Cynomolgus, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd28-protein-human-hek293.html

Purity

90.0

Smiles

NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP

Molecular Formula

940/102146670/705313 (Gene_ID) P10747-1/Q0PDN3/Q0PDN4 (N19-P152) (Accession)

Molecular Weight

34-44 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

β-Gal-PEG3-Amine
C53008-25MG 1 Unit

β-Gal-PEG3-Amine

Sign In for Pricing
View Details
Human RAF1 (NM_002880) AAV Particle
RC201983A1V 250 µL

Human RAF1 (NM_002880) AAV Particle

Sign In for Pricing
View Details
E2F1 Human shRNA Plasmid Kit (Locus ID 1869)
TR320325 1 Kit

E2F1 Human shRNA Plasmid Kit (Locus ID 1869)

Sign In for Pricing
View Details
Magic™ Human EGFR (K745, E746insIPVAIK) BaF3 Cell Line
S01YF-1222-KX735 1 Vial

Magic™ Human EGFR (K745, E746insIPVAIK) BaF3 Cell Line

Sign In for Pricing
View Details
Easypro Human Pedf (Pigment Epithelium Derived Factor) ELISA Kit
FY-EH2092S 96 Well

Easypro Human Pedf (Pigment Epithelium Derived Factor) ELISA Kit

Sign In for Pricing
View Details
KIF1C Protein Vector (Mouse) (pPB-C-His)
PV194234 500 ng

KIF1C Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details