Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-18 (Il18) (N36H, M85A, K87G, E90R, V91A, L94K)

Product Specifications

CAS Number

9000-83-3

Gene Name

Il18

UniProt

P70380

Expression Region

36-192aa (N36H, M85A, K87G, E90R, V91A, L94K)

Organism

Mus musculus

Target Sequence

HFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYAYGDSRARGKAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS

Tag

N-terminal 6xHis-tagged

Source

E.coli

Field of Research

Immunology

Assay Type

Developed Protein

Relevance

Regulatory light chain of myosin. Does not bind calcium.

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Length

Full Length of Mature Protein

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

24.0 kDa

References & Citations

"Mechanistic and structural basis for activation of cardiac myosin force production by omecamtiv mecarbil." Planelles-Herrero V.J., Hartman J.J., Robert-Paganin J., Malik F.I., Houdusse A. Nat Commun 8:190-190 (2017)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carf 3'UTR Luciferase Stable Cell Line
TU201666 1.0 mL

Carf 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GATA zinc finger domain-containing protein 1 (GATAD1) Bovine ELISA Kit
D6396 96 Tests

GATA zinc finger domain-containing protein 1 (GATAD1) Bovine ELISA Kit

Sign In for Pricing
View Details
Streptozocin discontinued. See 045318
294601-01 250 mg

Streptozocin discontinued. See 045318

Sign In for Pricing
View Details
Streptozocin discontinued. See 045318
294601-02 500 mg

Streptozocin discontinued. See 045318

Sign In for Pricing
View Details
Streptozocin discontinued. See 045318
294601-03 1 g

Streptozocin discontinued. See 045318

Sign In for Pricing
View Details
Streptozocin discontinued. See 045318
294601-04 2 g

Streptozocin discontinued. See 045318

Sign In for Pricing
View Details