PDGF-CC, Human (HEK293, Fc)
PDGF-CC is a multifunctional growth factor that plays a crucial role in embryonic development, cellular processes, and tissue formation. It is essential for embryonic skeletal development, skin morphogenesis, and wound healing. PDGF-CC Protein, Human (HEK293, Fc) is the recombinant human-derived PDGF-CC protein, expressed by HEK293 , with N-hFc labeled tag.
Product Specifications
Product Name Alternative
PDGF-CC Protein, Human (HEK293, Fc), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/pdgf-cc-protein-human-hek293-fc.html
Smiles
VVDLNLLTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSKVTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG
Molecular Formula
56034 (Gene_ID) Q9NRA1-1 (V235-G345) (Accession)
Molecular Weight
Approximately 45 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.
Shipping Conditions
Dry ice.
Scientific Category
Recombinant Proteins
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Human IgG Immunoglobulin (IG266), CF640R conjugate, 0.1mg/mL
TAG-72 / CA72.4 (B72.3), CF568 conjugate, 0.1mg/mL
Fibronectin (TV-1), CF568 conjugate, 0.1mg/mL
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
