Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPINK4, Mouse (HEK293, His)

The SPINK4 protein acts as a serine-type endopeptidase inhibitor, regulating peptidase activity.It is located in the extracellular region, suggesting that it has inhibitory functions outside the cell.SPINK4 Protein, Mouse (HEK293, His) is the recombinant mouse-derived SPINK4 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

SPINK4 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/spink4-protein-mouse-hek293-his.html

Purity

95.0

Smiles

GSLVFPRMPFCEHMAELPNCPQTPNLICGTDGLTYENECHLCLTRMKTMKDIQIMKDGQC

Molecular Formula

20731 (Gene_ID) NP_035593.2 (G27-C86) (Accession)

Molecular Weight

Approximately 8-11 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit
MBS2513711-01 24 Tests

Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit

Sign In for Pricing
View Details
Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit
MBS2513711-02 48 Tests

Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit

Sign In for Pricing
View Details
Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit
MBS2513711-03 96 Tests

Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit

Sign In for Pricing
View Details
Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit
MBS2513711-04 5x 96 Tests

Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit

Sign In for Pricing
View Details
Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit
MBS2513711-05 10x 96 Tests

Rabbit CX3CL1 (Chemokine C-X3-C-Motif Ligand) ELISA Kit

Sign In for Pricing
View Details
RecombinantIGF-I, Mouse
BK0085-01 10 µg

RecombinantIGF-I, Mouse

Sign In for Pricing
View Details