Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCIP-1/CXCL3, Mouse (CHO)

DCIP-1/CXCL3 Protein, Mouse (CHO) acts as a chemoattractant for neutrophils and is involved in the inflammatory response produced in CHO cells.

Product Specifications

Product Name Alternative

DCIP-1/CXCL3 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dcip-1-cxcl3-protein-mouse-cho.html

Purity

95.0

Smiles

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Molecular Formula

330122 (Gene_ID) Q6W5C0 (A28-S100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERK1 / ERK2 Rabbit Polyclonal Antibody
AP02741PU-N 100 µL

ERK1 / ERK2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-9E3), 1mg/mL
BNUM0010-50 1x 50 µL

MART-1 / Melan-A (M2-9E3), 1mg/mL

Sign In for Pricing
View Details
Texas Red Conjugated Goat Polyclonal Antibody to Human Immunoglobulins
TA-2103-2 2 mL

Texas Red Conjugated Goat Polyclonal Antibody to Human Immunoglobulins

Sign In for Pricing
View Details
CIB1 Mouse Monoclonal Antibody [Clone ID: 5A1F5E12]
AM06136SU-N 100 µL

CIB1 Mouse Monoclonal Antibody [Clone ID: 5A1F5E12]

Sign In for Pricing
View Details
Dishevelled 2 (DVL2) (C-term) Rabbit Polyclonal Antibody
AP51345PU-N 400 µL

Dishevelled 2 (DVL2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rolipram
SIH-401-10MG 10 mg

Rolipram

Sign In for Pricing
View Details