Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCIP-1/CXCL3, Mouse (CHO)

DCIP-1/CXCL3 Protein, Mouse (CHO) acts as a chemoattractant for neutrophils and is involved in the inflammatory response produced in CHO cells.

Product Specifications

Product Name Alternative

DCIP-1/CXCL3 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dcip-1-cxcl3-protein-mouse-cho.html

Purity

95.0

Smiles

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Molecular Formula

330122 (Gene_ID) Q6W5C0 (A28-S100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tuft1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7169507 1.0 µg DNA

Tuft1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Semaphorin 3c/SEMA3C Rabbit Polyclonal Antibody (HRP)
orb2609175 100 µg

Semaphorin 3c/SEMA3C Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
DYNLT1 (Dynein Light Chain Tctex-type 1, CW-1, TCTEL1, tctex-1) (MaxLight 750)
MBS6414867-01 0.1 mL

DYNLT1 (Dynein Light Chain Tctex-type 1, CW-1, TCTEL1, tctex-1) (MaxLight 750)

Sign In for Pricing
View Details
DYNLT1 (Dynein Light Chain Tctex-type 1, CW-1, TCTEL1, tctex-1) (MaxLight 750)
MBS6414867-02 5x 0.1 mL

DYNLT1 (Dynein Light Chain Tctex-type 1, CW-1, TCTEL1, tctex-1) (MaxLight 750)

Sign In for Pricing
View Details
PcDNA3.1-MAP3K7-Myc-His
PPL01009-2a 1 Each

PcDNA3.1-MAP3K7-Myc-His

Sign In for Pricing
View Details
Mouse Polycomb complex protein BMI-1 (BMI1) ELISA Kit
SL0761Mo-01 48 Tests

Mouse Polycomb complex protein BMI-1 (BMI1) ELISA Kit

Sign In for Pricing
View Details