Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCIP-1/CXCL3, Mouse (CHO)

DCIP-1/CXCL3 Protein, Mouse (CHO) acts as a chemoattractant for neutrophils and is involved in the inflammatory response produced in CHO cells.

Product Specifications

Product Name Alternative

DCIP-1/CXCL3 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dcip-1-cxcl3-protein-mouse-cho.html

Purity

95.0

Smiles

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Molecular Formula

330122 (Gene_ID) Q6W5C0 (A28-S100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ICAM1 Antibody Picoband®, FITC Conjugate
A00171-2-FITC 100 µg/Vial

Anti-ICAM1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Phospho-CdGAP (Thr789) Peptide
AF8252-BP 1 mg

Phospho-CdGAP (Thr789) Peptide

Sign In for Pricing
View Details
Sanbr Mouse shRNA Lentiviral Particle (Locus ID 71675)
TL504579V 500 µL Each

Sanbr Mouse shRNA Lentiviral Particle (Locus ID 71675)

Sign In for Pricing
View Details
Lentiviral mouse C4bp shRNA (UAS) - Lentiviral mouseC4bp shRNA (UAS, GFP) (25)
GTR15223928 1 Vial

Lentiviral mouse C4bp shRNA (UAS) - Lentiviral mouseC4bp shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
OGA (NM_001142434) Human Untagged Clone
SC326262 10 µg

OGA (NM_001142434) Human Untagged Clone

Sign In for Pricing
View Details
Anti-PPIL1 Rabbit pAb
GB113357 100 μL

Anti-PPIL1 Rabbit pAb

Sign In for Pricing
View Details