Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DCIP-1/CXCL3, Mouse (CHO)

DCIP-1/CXCL3 Protein, Mouse (CHO) acts as a chemoattractant for neutrophils and is involved in the inflammatory response produced in CHO cells.

Product Specifications

Product Name Alternative

DCIP-1/CXCL3 Protein, Mouse (CHO), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dcip-1-cxcl3-protein-mouse-cho.html

Purity

95.0

Smiles

AVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS

Molecular Formula

330122 (Gene_ID) Q6W5C0 (A28-S100) (Accession)

Molecular Weight

Approximately 11 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSCD4 antibody - N-terminal region
MBS3211960-01 0.1 mL

PSCD4 antibody - N-terminal region

Sign In for Pricing
View Details
PSCD4 antibody - N-terminal region
MBS3211960-02 5x 0.1 mL

PSCD4 antibody - N-terminal region

Sign In for Pricing
View Details
Human IgG (H&L) Antibody F (ab') 2 - PE Conjugated
OARA04563-1ML 500 µg

Human IgG (H&L) Antibody F (ab') 2 - PE Conjugated

Sign In for Pricing
View Details
UQCRB, ID (UQCRB, UQBP, Cytochrome b-c1 complex subunit 7, Complex III subunit 7, Complex III subunit VII, QP-C, Ubiquinol-cytochrome c reductase complex 14kD protein) (FITC)
MBS6361677-01 0.2 mL

UQCRB, ID (UQCRB, UQBP, Cytochrome b-c1 complex subunit 7, Complex III subunit 7, Complex III subunit VII, QP-C, Ubiquinol-cytochrome c reductase complex 14kD protein) (FITC)

Sign In for Pricing
View Details
UQCRB, ID (UQCRB, UQBP, Cytochrome b-c1 complex subunit 7, Complex III subunit 7, Complex III subunit VII, QP-C, Ubiquinol-cytochrome c reductase complex 14kD protein) (FITC)
MBS6361677-02 5x 0.2 mL

UQCRB, ID (UQCRB, UQBP, Cytochrome b-c1 complex subunit 7, Complex III subunit 7, Complex III subunit VII, QP-C, Ubiquinol-cytochrome c reductase complex 14kD protein) (FITC)

Sign In for Pricing
View Details
AQP1 Recombinant Antibody, PerCP Conjugated
bsm-52909R-PerCP-01 20 µL

AQP1 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details