Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Beta-defensin 6 (Defb6)

Product Specifications

Product Name Alternative

(BD-6) (mBD-6) (Defensin, beta 6)

Abbreviation

Recombinant Mouse Defb6 protein

Gene Name

Defb6

UniProt

Q91VD6

Expression Region

23-63aa

Organism

Mus musculus (Mouse)

Target Sequence

QLINSPVTCMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK

Tag

N-terminal GST-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Immunology

Relevance

Has potent antibacterial activity against E.coli (ATCC 25922) .

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31.1 kDa

References & Citations

"A novel mouse beta-defensin, mBD-6, predominantly expressed in skeletal muscle." Yamaguchi Y., Fukuhara S., Nagase T., Tomita T., Hitomi S., Kimura S., Kurihara H., Ouchi Y. J. Biol. Chem. 276:31510-31514 (2001)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Rectum
CR559196 5 µg

Tissue Total RNA, Rectum

Sign In for Pricing
View Details
FSH beta (FSHb/1062), Biotin conjugate, 0.1mg/mL
BNCB1062-500 1x 500 µL

FSH beta (FSHb/1062), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human/Mouse KLRG-1 Antibody
RD30512F-01 25 µg

PE/Cyanine7 Anti-Human/Mouse KLRG-1 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Human/Mouse KLRG-1 Antibody
RD30512F-02 100 µg

PE/Cyanine7 Anti-Human/Mouse KLRG-1 Antibody

Sign In for Pricing
View Details
MyBlock™ Mini Dry Bath, 100-240V (US Plug)
BSH200 1 Each

MyBlock™ Mini Dry Bath, 100-240V (US Plug)

Sign In for Pricing
View Details
Adssl1 Mouse Gene Knockout Kit (CRISPR)
KN300941BN 1 Kit

Adssl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details