Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD74, Mouse (160a.a, HEK293, His)

The CD74 protein is significantly expressed in the thymus and lymph nodes, suggesting that it plays a key role in regulating immune system function. Its presence in the thymus, a key site for T cell development, underscores its important role in overseeing key cellular processes required for immune maturation. CD74 Protein, Mouse (160a.a, HEK293, His) is the recombinant mouse-derived CD74 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD74 Protein, Mouse (160a.a, HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd74-protein-mouse-160a-a-hek293-his.html

Purity

98.0

Smiles

QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKEPLDMEDLSSGLGVTRQELGQVTL

Molecular Formula

16149 (Gene_ID) P04441-2 (Q56-L215) (Accession)

Molecular Weight

25-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Homeobox protein EMX2
BP3606-50ug 50 µg

Recombinant Human Homeobox protein EMX2

Sign In for Pricing
View Details
GCNT6 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-13318R-BF680 100 µL

GCNT6 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Recombinant Mouse EFNA5
MBS7621775-01 0.01 mg

Recombinant Mouse EFNA5

Sign In for Pricing
View Details
Recombinant Mouse EFNA5
MBS7621775-02 0.05 mg

Recombinant Mouse EFNA5

Sign In for Pricing
View Details
Recombinant Mouse EFNA5
MBS7621775-03 0.5 mg

Recombinant Mouse EFNA5

Sign In for Pricing
View Details
Recombinant Mouse EFNA5
MBS7621775-04 1 mg

Recombinant Mouse EFNA5

Sign In for Pricing
View Details