Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOX-1/OLR1, Rat (HEK293, His)

The LOX-1/OLR1 protein plays an important role as a receptor that recognizes, internalizes, and degrades oxidatively modified low-density lipoprotein (oxLDL), a marker of atherosclerosis, in vascular endothelial cells. OxLDL induces endothelial dysfunction, triggering pro-inflammatory responses, oxidative conditions, and apoptosis. LOX-1/OLR1 Protein, Rat (HEK293, His) is the recombinant rat-derived LOX-1/OLR1 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

LOX-1/OLR1 Protein, Rat (HEK293, His), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/lox-1-olr1-protein-rat-hek293-his.html

Purity

93.00

Smiles

LQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ

Molecular Formula

140914 (Gene_ID) O70156 (L60-Q364) (Accession)

Molecular Weight

Approximately 38-55 kDa due to the glycosylation

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endothelium Mouse Monoclonal Antibody [Clone ID: OX-43]
CL116A 1 mg

Endothelium Mouse Monoclonal Antibody [Clone ID: OX-43]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991I-01 50 Tests

PE/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991I-02 100 Tests

PE/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]
E-AB-F0991I-03 2x 100 Tests

PE/Cyanine5.5 Anti-Mouse CD11c Antibody[N418]

Sign In for Pricing
View Details
Fluorescent Brightener 87 (Technical Grade)
TRC-F401320-50G 50 g

Fluorescent Brightener 87 (Technical Grade)

Sign In for Pricing
View Details
GALK2 (NM_002044) Human Over-expression Lysate
LC400749 20 µg

GALK2 (NM_002044) Human Over-expression Lysate

Sign In for Pricing
View Details