Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA3, Human (HEK293, His)

The EphA3 protein is a receptor tyrosine kinase that promiscuously binds to membrane-bound ephrin ligands to initiate bidirectional signaling. Activation of EphA3 is known to preferentially bind to EFNA5 and regulates cell-cell adhesion, cytoskeletal organization, and migration. EphA3 Protein, Human (HEK293, His) is the recombinant human-derived EphA3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EphA3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha3-protein-human-hek-293-his.html

Purity

95.0

Smiles

ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ

Molecular Formula

2042 (Gene_ID) P29320-1 (E21-Q541) (Accession)

Molecular Weight

Approximately 67.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)
MBS1345112-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)
MBS1345112-02 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)
MBS1345112-03 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)
MBS1345112-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)
MBS1345112-05 0.02 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)
MBS1345112-06 0.02 mg (Mammalian-Cell)

Recombinant Schizosaccharomyces pombe L-ornithine 5-monooxygenase (sib2)

Sign In for Pricing
View Details