Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EphA3, Human (HEK293, His)

The EphA3 protein is a receptor tyrosine kinase that promiscuously binds to membrane-bound ephrin ligands to initiate bidirectional signaling. Activation of EphA3 is known to preferentially bind to EFNA5 and regulates cell-cell adhesion, cytoskeletal organization, and migration. EphA3 Protein, Human (HEK293, His) is the recombinant human-derived EphA3 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

EphA3 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/epha3-protein-human-hek-293-his.html

Purity

95.0

Smiles

ELIPQPSNEVNLLDSKTIQGELGWISYPSHGWEEISGVDEHYTPIRTYQVCNVMDHSQNNWLRTNWVPRNSAQKIYVELKFTLRDCNSIPLVLGTCKETFNLYYMESDDDHGVKFREHQFTKIDTIAADESFTQMDLGDRILKLNTEIREVGPVNKKGFYLAFQDVGACVALVSVRVYFKKCPFTVKNLAMFPDTVPMDSQSLVEVRGSCVNNSKEEDPPRMYCSTEGEWLVPIGKCSCNAGYEERGFMCQACRPGFYKALDGNMKCAKCPPHSSTQEDGSMNCRCENNYFRADKDPPSMACTRPPSSPRNVISNINETSVILDWSWPLDTGGRKDVTFNIICKKCGWNIKQCEPCSPNVRFLPRQFGLTNTTVTVTDLLAHTNYTFEIDAVNGVSELSSPPRQFAAVSITTNQAAPSPVLTIKKDRTSRNSISLSWQEPEHPNGIILDYEVKYYEKQEQETSYTILRARGTNVTISSLKPDTIYVFQIRARTAAGYGTNSRKFEFETSPDSFSISGESSQ

Molecular Formula

2042 (Gene_ID) P29320-1 (E21-Q541) (Accession)

Molecular Weight

Approximately 67.0 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PPM1H, ID (PPM1H, ARHCL1, KIAA1157, URCC2, Protein phosphatase 1H)
040327 200 µL

PPM1H, ID (PPM1H, ARHCL1, KIAA1157, URCC2, Protein phosphatase 1H)

Ask
View Details
Vmn1r47 Mouse Gene Knockout Kit (CRISPR)
KN519060 1 Kit

Vmn1r47 Mouse Gene Knockout Kit (CRISPR)

Ask
View Details
Plcxd1 (NM_207279) Mouse Tagged ORF Clone Lentiviral Particle
MR216076L3V 200 µL

Plcxd1 (NM_207279) Mouse Tagged ORF Clone Lentiviral Particle

Ask
View Details
Human Islet Amyloid Polypeptide (IAPP) ELISA Kit DIY Materials
MBS2088821-01 5x 96 Tests

Human Islet Amyloid Polypeptide (IAPP) ELISA Kit DIY Materials

Ask
View Details
Human Islet Amyloid Polypeptide (IAPP) ELISA Kit DIY Materials
MBS2088821-02 5x 96 Tests + MBS2089472 (Support Pack 2,5x 96 Tests)

Human Islet Amyloid Polypeptide (IAPP) ELISA Kit DIY Materials

Ask
View Details
Human Islet Amyloid Polypeptide (IAPP) ELISA Kit DIY Materials
MBS2088821-03 10x 96 Tests

Human Islet Amyloid Polypeptide (IAPP) ELISA Kit DIY Materials

Ask
View Details