Histone H3, Xenopus laevis (98a.a, His)
Histone H3 Protein constitutes a core element in the nucleosome, an octamer comprising H2A, H2B, H3, and H4. The assembly forms a histone octamer with one H3-H4 heterotetramer and two H2A-H2B heterodimers, serving as a molecular spool that wraps around 147 base pairs of DNA. This compact organization contributes to chromatin structure, and Histone H3, as part of this assembly, plays a crucial role in chromatin structure and gene regulation. Histone H3 Protein, Xenopus laevis (98a.a, His) is the recombinant Xenopus laevis-derived Histone H3 protein, expressed by E. coli , with tag free.
Product Specifications
Product Name Alternative
Histone H3 Protein, Xenopus laevis (98a.a, His), Xenopus laevis, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/histone-h3-protein-xenopus-laevis-98a-a.html
Purity
98.0
Smiles
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Molecular Formula
399088 (Gene_ID) Q92133 (P39-A136) (Accession)
Molecular Weight
Approximately 13 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog