Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QTNF3/CTRP3, Human (His)

C1QTNF3/CTRP3 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. C1QTNF3/CTRP3 Protein by participating in the TGF-1/Smad, Sirtuin 1/NF-B, AMPK and Signaling pathways such as LAMP1/JIP2/JNK have extensive effects on tumor, inflammation, metabolism, and insulin sensitization. C1QTNF3/CTRP3 Protein, Human (His) is the recombinant human-derived C1QTNF3/CTRP3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

C1QTNF3/CTRP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1qtnf3-ctrp3-protein-human-his.html

Purity

95.00

Smiles

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Molecular Formula

114899 (Gene_ID) Q9BXJ4-1 (Q23-K246) (Accession)

Molecular Weight

Approximately 25-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Peritoneum
CS712914 5x 5 µm

Tissue FFPE Sections, Peritoneum

Sign In for Pricing
View Details
1,2-Dibromo-4-(3-bromophenoxy)benzene
TRC-D422895-50MG 50 mg

1,2-Dibromo-4-(3-bromophenoxy)benzene

Sign In for Pricing
View Details
Human ZNF512B activation kit by CRISPRa
GA111518 1 Kit

Human ZNF512B activation kit by CRISPRa

Sign In for Pricing
View Details
DGAT2L6 Antibody
8C15350-AAT 50 µg

DGAT2L6 Antibody

Sign In for Pricing
View Details
Prolactin (Pituitary Tumor Marker) (PRL/2642), CF594 conjugate, 0.1mg/mL
BNC942642-500 1x 500 µL

Prolactin (Pituitary Tumor Marker) (PRL/2642), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cortactin Recombinant Rabbit Monoclonal Antibody [SC61-08]
ET1610-87 100 µL

Cortactin Recombinant Rabbit Monoclonal Antibody [SC61-08]

Sign In for Pricing
View Details