Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QTNF3/CTRP3, Human (His)

C1QTNF3/CTRP3 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. C1QTNF3/CTRP3 Protein by participating in the TGF-1/Smad, Sirtuin 1/NF-B, AMPK and Signaling pathways such as LAMP1/JIP2/JNK have extensive effects on tumor, inflammation, metabolism, and insulin sensitization. C1QTNF3/CTRP3 Protein, Human (His) is the recombinant human-derived C1QTNF3/CTRP3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

C1QTNF3/CTRP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1qtnf3-ctrp3-protein-human-his.html

Purity

95.00

Smiles

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Molecular Formula

114899 (Gene_ID) Q9BXJ4-1 (Q23-K246) (Accession)

Molecular Weight

Approximately 25-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CASP3 Polyclonal Antibody
E-AB-70388-01 60 µL

CASP3 Polyclonal Antibody

Sign In for Pricing
View Details
CASP3 Polyclonal Antibody
E-AB-70388-02 120 µL

CASP3 Polyclonal Antibody

Sign In for Pricing
View Details
CASP3 Polyclonal Antibody
E-AB-70388-03 200 µL

CASP3 Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome C (CYCS) (C-term) Rabbit Polyclonal Antibody
AP23373PU-N 100 µg

Cytochrome C (CYCS) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IGF1R/CD221/IGF-I R protein (His tag)
PDEH100946-01 20 µg

Recombinant Human IGF1R/CD221/IGF-I R protein (His tag)

Sign In for Pricing
View Details
Recombinant Human IGF1R/CD221/IGF-I R protein (His tag)
PDEH100946-02 100 µg

Recombinant Human IGF1R/CD221/IGF-I R protein (His tag)

Sign In for Pricing
View Details