Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QTNF3/CTRP3, Human (His)

C1QTNF3/CTRP3 Protein is a secreted protein of the C1q/ TNF-associated protein (CTRPs) family. C1QTNF3/CTRP3 Protein by participating in the TGF-1/Smad, Sirtuin 1/NF-B, AMPK and Signaling pathways such as LAMP1/JIP2/JNK have extensive effects on tumor, inflammation, metabolism, and insulin sensitization. C1QTNF3/CTRP3 Protein, Human (His) is the recombinant human-derived C1QTNF3/CTRP3 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

C1QTNF3/CTRP3 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/c1qtnf3-ctrp3-protein-human-his.html

Purity

95.00

Smiles

QDEYMESPQTGGLPPDCSKCCHGDYSFRGYQGPPGPPGPPGIPGNHGNNGNNGATGHEGAKGEKGDKGDLGPRGERGQHGPKGEKGYPGIPPELQIAFMASLATHFSNQNSGIIFSSVETNIGNFFDVMTGRFGAPVSGVYFFTFSMMKHEDVEEVYVYLMHNGNTVFSMYSYEMKGKSDTSSNHAVLKLAKGDEVWLRMGNGALHGDHQRFSTFAGFLLFETK

Molecular Formula

114899 (Gene_ID) Q9BXJ4-1 (Q23-K246) (Accession)

Molecular Weight

Approximately 25-28 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STIM2 Rabbit Polyclonal Antibody
TA382115 100 µL

STIM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
4'-Hydroxyacetophenone
TRC-H739980-5G 5 g

4'-Hydroxyacetophenone

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799 + KRT19/800), CF488A conjugate, 0.1mg/mL
BNC881150-100 1x 100 µL

Cytokeratin 19 (KRT19/799 + KRT19/800), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS714449 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
MelanA (mLANA) (NM_005511) Human Recombinant Protein
TP304190L 1 mg

MelanA (mLANA) (NM_005511) Human Recombinant Protein

Sign In for Pricing
View Details
L-3-Nitrophenylalanine
TRC-N502250-250MG 250 mg

L-3-Nitrophenylalanine

Sign In for Pricing
View Details