Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKT3, Mouse (sf9)

The AKT3 protein is part of the AKT kinase family and regulates a variety of cellular processes, including metabolism, proliferation, and survival.Its least-studied isoform, AKT3, is critical for brain development and is critical for the viability of malignant glioma cells.AKT3 Protein, Mouse (sf9) is the recombinant mouse-derived AKT3 protein, expressed by Sf9 insect cells , with tag free.

Product Specifications

Product Name Alternative

AKT3 Protein, Mouse (sf9), Mouse, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/akt3-protein-mouse-sf9.html

Smiles

ADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE

Molecular Formula

23797 (Gene_ID) Q9WUA6-1 (A106-E479) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF647 conjugate, 0.1mg/mL
BNC470183-100 1x 100 µL

Cytochrome C (Mitochondrial Marker) (7H8.2C12), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ID4 (N-term) Rabbit Polyclonal Antibody
AP01280PU-N 100 µg

ID4 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Delegol T
TRC-D389940-1G 1 g

Delegol T

Sign In for Pricing
View Details
CCDC13 (N-term) Rabbit Polyclonal Antibody
AP50765PU-N 400 µL

CCDC13 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI6D8]
CF806318 100 µg

NR0B2 Mouse Monoclonal Antibody [Clone ID: OTI6D8]

Sign In for Pricing
View Details
Recombinant LAT (phospho Y191) Antibody
RC-16334-01 50 μL

Recombinant LAT (phospho Y191) Antibody

Sign In for Pricing
View Details