Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKT3, Mouse (sf9)

The AKT3 protein is part of the AKT kinase family and regulates a variety of cellular processes, including metabolism, proliferation, and survival.Its least-studied isoform, AKT3, is critical for brain development and is critical for the viability of malignant glioma cells.AKT3 Protein, Mouse (sf9) is the recombinant mouse-derived AKT3 protein, expressed by Sf9 insect cells , with tag free.

Product Specifications

Product Name Alternative

AKT3 Protein, Mouse (sf9), Mouse, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/akt3-protein-mouse-sf9.html

Smiles

ADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE

Molecular Formula

23797 (Gene_ID) Q9WUA6-1 (A106-E479) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse C-type natriuretic peptide,CNP ELISA Kit
CN-02575M2 48T

Mouse C-type natriuretic peptide,CNP ELISA Kit

Ask
View Details
Rabbit Polyclonal FKBP15 Antibody [FITC]
NB100-424F 0.1 mL

Rabbit Polyclonal FKBP15 Antibody [FITC]

Ask
View Details
MKL1, ID (MKL1, KIAA1438, MAL, MKL/myocardin-like protein 1, Megakaryoblastic leukemia 1 protein, Megakaryocytic acute leukemia protein, Myocardin-related transcription factor A) (MaxLight 550)
MBS6320961-01 0.1 mL

MKL1, ID (MKL1, KIAA1438, MAL, MKL/myocardin-like protein 1, Megakaryoblastic leukemia 1 protein, Megakaryocytic acute leukemia protein, Myocardin-related transcription factor A) (MaxLight 550)

Ask
View Details
MKL1, ID (MKL1, KIAA1438, MAL, MKL/myocardin-like protein 1, Megakaryoblastic leukemia 1 protein, Megakaryocytic acute leukemia protein, Myocardin-related transcription factor A) (MaxLight 550)
MBS6320961-02 5x 0.1 mL

MKL1, ID (MKL1, KIAA1438, MAL, MKL/myocardin-like protein 1, Megakaryoblastic leukemia 1 protein, Megakaryocytic acute leukemia protein, Myocardin-related transcription factor A) (MaxLight 550)

Ask
View Details
IER5 siRNA (Mouse)
CRM1993-01 15 nmol

IER5 siRNA (Mouse)

Ask
View Details
IER5 siRNA (Mouse)
CRM1993-02 30 nmol

IER5 siRNA (Mouse)

Ask
View Details