Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKT3, Mouse (sf9)

The AKT3 protein is part of the AKT kinase family and regulates a variety of cellular processes, including metabolism, proliferation, and survival.Its least-studied isoform, AKT3, is critical for brain development and is critical for the viability of malignant glioma cells.AKT3 Protein, Mouse (sf9) is the recombinant mouse-derived AKT3 protein, expressed by Sf9 insect cells , with tag free.

Product Specifications

Product Name Alternative

AKT3 Protein, Mouse (sf9), Mouse, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/akt3-protein-mouse-sf9.html

Smiles

ADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE

Molecular Formula

23797 (Gene_ID) Q9WUA6-1 (A106-E479) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Mouse Lysyl oxidase homolog 4 ELISA Kit
MBS9425611-01 96 Tests

Mouse Lysyl oxidase homolog 4 ELISA Kit

Ask
View Details
Mouse Lysyl oxidase homolog 4 ELISA Kit
MBS9425611-02 5x 96 Tests

Mouse Lysyl oxidase homolog 4 ELISA Kit

Ask
View Details
SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) (MaxLight 405) discontinued
133283-ML405 100 µL

SH2D1A (SH2 Domain-containing Protein 1A, Duncan Disease SH2-protein, Signaling Lymphocytic Activation Molecule-associated Protein, SLAM-associated Protein, T-cell Signal Transduction Molecule SAP, DSHP, SAP, FLJ18687, FLJ92177) (MaxLight 405) discontinued

Ask
View Details
Docking Protein 2 (DOK2) Antibody (Biotin)
abx312688-01 20 µg

Docking Protein 2 (DOK2) Antibody (Biotin)

Ask
View Details
Docking Protein 2 (DOK2) Antibody (Biotin)
abx312688-02 50 µg

Docking Protein 2 (DOK2) Antibody (Biotin)

Ask
View Details
Docking Protein 2 (DOK2) Antibody (Biotin)
abx312688-03 100 µg

Docking Protein 2 (DOK2) Antibody (Biotin)

Ask
View Details