Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKT3, Mouse (sf9)

The AKT3 protein is part of the AKT kinase family and regulates a variety of cellular processes, including metabolism, proliferation, and survival.Its least-studied isoform, AKT3, is critical for brain development and is critical for the viability of malignant glioma cells.AKT3 Protein, Mouse (sf9) is the recombinant mouse-derived AKT3 protein, expressed by Sf9 insect cells , with tag free.

Product Specifications

Product Name Alternative

AKT3 Protein, Mouse (sf9), Mouse, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/akt3-protein-mouse-sf9.html

Smiles

ADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLLGKGTFGKVILVREKASGKYYAMKILKKEVIIAKDEVAHTLTESRVLKNTRHPFLTSLKYSFQTKDRLCFVMEYVNGGELFFHLSRERVFSEDRTRFYGAEIVSALDYLHSGKIVYRDLKLENLMLDKDGHIKITDFGLCKEGITDAATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEDIKFPRTLSSDAKSLLSGLLIKDPNKRLGGGPDDAKEIMRHSFFSGVNWQDVYDKKLVPPFKPQVTSETDTRYFDEEFTAQTITITPPEKYDDDGMDGMDNERRPHFPQFSYSASGRE

Molecular Formula

23797 (Gene_ID) Q9WUA6-1 (A106-E479) (Accession)

Molecular Weight

Approximately 46 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIDE1 (C19orf38) (Center) Rabbit Polyclonal Antibody
AP50512PU-N 400 µL

HIDE1 (C19orf38) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF594 conjugate, 0.1mg/mL
BNC941389-100 1x 100 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1389), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995UD-01 25 µg

PE Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
PE Anti-Mouse F4/80 Antibody[CI:A3-1]
E-AB-F0995UD-02 100 µg

PE Anti-Mouse F4/80 Antibody[CI:A3-1]

Sign In for Pricing
View Details
Recombinant Mouse MBL2/MBL/COLEC1 Protein (His Tag)
PKSM040947 50 µg

Recombinant Mouse MBL2/MBL/COLEC1 Protein (His Tag)

Sign In for Pricing
View Details
CENPF Rabbit Polyclonal Antibody
TA367010 100 µL

CENPF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details