Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NM23A (NME1) (NM_198175) Human 3' UTR Clone
SC202994 10 µg

NM23A (NME1) (NM_198175) Human 3' UTR Clone

Sign In for Pricing
View Details
Olfr1058 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4130503 1.0 µg DNA

Olfr1058 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Rabbit Anti-ARL8B antibody
SL20099R-01 50 µL

Rabbit Anti-ARL8B antibody

Sign In for Pricing
View Details
Rabbit Anti-ARL8B antibody
SL20099R-02 100 µL

Rabbit Anti-ARL8B antibody

Sign In for Pricing
View Details
Porcine PDZ and LIM Domain Protein 4 (PDLIM4) ELISA Kit
MBS9937387-01 48 Well

Porcine PDZ and LIM Domain Protein 4 (PDLIM4) ELISA Kit

Sign In for Pricing
View Details
Porcine PDZ and LIM Domain Protein 4 (PDLIM4) ELISA Kit
MBS9937387-02 96 Well

Porcine PDZ and LIM Domain Protein 4 (PDLIM4) ELISA Kit

Sign In for Pricing
View Details