Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pld2 qPCR Primer Pair
QM19002S 200 Tests

Mouse Pld2 qPCR Primer Pair

Sign In for Pricing
View Details
Clca4c-ps Mouse shRNA Plasmid (Locus ID 622139)
TR508957 1 Kit

Clca4c-ps Mouse shRNA Plasmid (Locus ID 622139)

Sign In for Pricing
View Details
SRP1 (KPNA1) Human Recombinant Protein
TP725572 50 µg

SRP1 (KPNA1) Human Recombinant Protein

Sign In for Pricing
View Details
Lentiviral mouse Pex11b shRNA (UAS) - Lentiviral mouse Pex11b shRNA (UAS) plasmid
GTR15221911 1 Vial

Lentiviral mouse Pex11b shRNA (UAS) - Lentiviral mouse Pex11b shRNA (UAS) plasmid

Sign In for Pricing
View Details
ErbB4/HER4 Rabbit mAb
E45R13128N-50 50 µL

ErbB4/HER4 Rabbit mAb

Sign In for Pricing
View Details
CD117 Mouse -APC/CY7, Antibody
GWB-CBCFEE 0.1 mg

CD117 Mouse -APC/CY7, Antibody

Sign In for Pricing
View Details