Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm3417 (NM_001123368) Mouse Tagged Lenti ORF Clone
MR212276L4 10 µg

Gm3417 (NM_001123368) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
UGT2A1 Rabbit Polyclonal Antibody
TA360799 100 µL

UGT2A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AF4 Antibody
MBS5316205-01 0.1 mL

AF4 Antibody

Sign In for Pricing
View Details
AF4 Antibody
MBS5316205-02 5x 0.1 mL

AF4 Antibody

Sign In for Pricing
View Details
Anserini UU-Ab ELISA Kit
EAU0025 96 Tests

Anserini UU-Ab ELISA Kit

Sign In for Pricing
View Details
CD37 Human Pre-designed siRNA Set A
HY-RS02238 1 Set

CD37 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details