Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kat14 (NM_001191855) Rat Untagged Clone
RN217202 10 µg

Kat14 (NM_001191855) Rat Untagged Clone

Sign In for Pricing
View Details
Ankrd22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6337608 1.0 µg DNA

Ankrd22 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal SMC1 [p Ser966] Antibody [CoraFluor 1]
NB100-206CL1 0.1 mL

Rabbit Polyclonal SMC1 [p Ser966] Antibody [CoraFluor 1]

Sign In for Pricing
View Details
SERPINA5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV659551 1.0 µg DNA

SERPINA5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Group B Streptococcus Nucleic Acid Detection Kit (Fluorescence PCR)
HWTS-UR027A 1 Kit

Group B Streptococcus Nucleic Acid Detection Kit (Fluorescence PCR)

Sign In for Pricing
View Details
Methyl 2-Acetamido-4,6-O-benzylidene-3-O- (2,3,4,6-tetra-O-acetyl-β-D-galactopyranosyl-2-deoxy-β-D-glucopyranoside
sc-224066 25 mg

Methyl 2-Acetamido-4,6-O-benzylidene-3-O- (2,3,4,6-tetra-O-acetyl-β-D-galactopyranosyl-2-deoxy-β-D-glucopyranoside

Sign In for Pricing
View Details