Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Serotonin ELISA Fast Track
BA E-8900 96 Determinations

Serotonin ELISA Fast Track

Sign In for Pricing
View Details
Lentiviral human IDS sgRNA gene knockout kit - Lentiviral human IDS sgRNA gene knockout kit (plasmid)
GTR15368174 1 Vial

Lentiviral human IDS sgRNA gene knockout kit - Lentiviral human IDS sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Amyloid beta-Protein (3-42)
MBS5824773 Inquire

Amyloid beta-Protein (3-42)

Sign In for Pricing
View Details
AFAP1 Recombinant Protein
32-3162-10 10 µg

AFAP1 Recombinant Protein

Sign In for Pricing
View Details
Endog (NM_001034938) Rat Untagged Clone
RN204090 10 µg

Endog (NM_001034938) Rat Untagged Clone

Sign In for Pricing
View Details
Human ZNF444 shRNA Plasmid
abx960643-01 150 µg

Human ZNF444 shRNA Plasmid

Sign In for Pricing
View Details