Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1245 Recombinant Protein (Rat)
RP215642 100 µg

Olr1245 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Cyp3a2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV678777 1.0 µg DNA

Cyp3a2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Lentiviral mouse Vmn1r65 shRNA (UAS) - Lentiviral mouse Vmn1r65 shRNA (UAS) plasmid
GTR15146923 1 Vial

Lentiviral mouse Vmn1r65 shRNA (UAS) - Lentiviral mouse Vmn1r65 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Human S100 Calcium Binding Protein P
7-06304 2 µg

Recombinant Human S100 Calcium Binding Protein P

Sign In for Pricing
View Details
Rabbit Polyclonal CHMP2A Antibody [mFluor Violet 500 SE]
NBP2-97282MFV500 0.1 mL

Rabbit Polyclonal CHMP2A Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Tssc4 ORF Vector (Rat) (pORF)
ORF078356 1.0 µg DNA

Tssc4 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details