Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGCB Polyclonal Antibody
JOT-AP12971-01 50ul

PGCB Polyclonal Antibody

Sign In for Pricing
View Details
PGCB Polyclonal Antibody
JOT-AP12971-02 100ul

PGCB Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Mouse Tmem29
Y019003 100 µL

Anti-Mouse Tmem29

Sign In for Pricing
View Details
PDAP1, CT (28kD Heat-and Acid-stable Phosphoprotein, PDGF-associated Protein, PAP, PDGFA-associated Protein 1, PAP1, HASPP28) (MaxLight 650) discontinued
P3120-95C-ML650 100 µL

PDAP1, CT (28kD Heat-and Acid-stable Phosphoprotein, PDGF-associated Protein, PAP, PDGFA-associated Protein 1, PAP1, HASPP28) (MaxLight 650) discontinued

Sign In for Pricing
View Details
GENLISA Human C-Src Tyrosine Kinase (CSK) ELISA
KBH9517 1x 96 Well

GENLISA Human C-Src Tyrosine Kinase (CSK) ELISA

Sign In for Pricing
View Details
Rabbit Anti-Cdk6 antibody
SLM-52030R-01 50 µL

Rabbit Anti-Cdk6 antibody

Sign In for Pricing
View Details