Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Coa3 shRNA (UAS) - Lentiviral mouse Coa3 shRNA (UAS) (25)
GTR15201113 1 Vial

Lentiviral mouse Coa3 shRNA (UAS) - Lentiviral mouse Coa3 shRNA (UAS) (25)

Sign In for Pricing
View Details
Prap1 AAV siRNA Pooled Vector
37556164 1.0 µg

Prap1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
RPS5P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2013107 1.0 µg DNA

RPS5P1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Human OR4D2 shRNA Plasmid
abx964768-01 150 µg

Human OR4D2 shRNA Plasmid

Sign In for Pricing
View Details
Human OR4D2 shRNA Plasmid
abx964768-02 300 µg

Human OR4D2 shRNA Plasmid

Sign In for Pricing
View Details
Mmu-miR-5123 inhibitor
HY-RI03267-01 5 nmol

Mmu-miR-5123 inhibitor

Sign In for Pricing
View Details