Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF224 Antibody, HRP conjugated
MBS7110048-01 0.05 mg

ZNF224 Antibody, HRP conjugated

Sign In for Pricing
View Details
ZNF224 Antibody, HRP conjugated
MBS7110048-02 0.1 mg

ZNF224 Antibody, HRP conjugated

Sign In for Pricing
View Details
ZNF224 Antibody, HRP conjugated
MBS7110048-03 5x 0.1 mg

ZNF224 Antibody, HRP conjugated

Sign In for Pricing
View Details
YES1 3'UTR Luciferase Stable Cell Line
TU028640 1.0 mL

YES1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Plaur Mouse Gene Knockout Kit (CRISPR)
KN513408 1 Kit

Plaur Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IGKV3D-7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1059108 1.0 µg DNA

IGKV3D-7 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details