Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rotavirus (PE)
MBS6125939-01 0.1 mL

Rotavirus (PE)

Sign In for Pricing
View Details
Rotavirus (PE)
MBS6125939-02 5x 0.1 mL

Rotavirus (PE)

Sign In for Pricing
View Details
Lentiviral mouse Trpm2 shRNA (UAS) - Lentiviral mouse Trpm2 shRNA (UAS) (25)
GTR15210449 1 Vial

Lentiviral mouse Trpm2 shRNA (UAS) - Lentiviral mouse Trpm2 shRNA (UAS) (25)

Sign In for Pricing
View Details
Biotinylated Anti-IL4RA antibody (EN0C284) ; IgG1 Chimeric mAb
E33C100284B 100 µL

Biotinylated Anti-IL4RA antibody (EN0C284) ; IgG1 Chimeric mAb

Sign In for Pricing
View Details
RGD1561157 Protein Vector (Rat) (pPB-N-His)
PV300367 500 ng

RGD1561157 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Relaxin 2 (Relaxin-2) (HRP)
MBS6404838-01 0.01 mL

Relaxin 2 (Relaxin-2) (HRP)

Sign In for Pricing
View Details