Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMP-2, Human (HEK293, His)

TIMP-2 protein is a tissue inhibitor of metalloproteinases that can bind and inactivate various metalloproteinases, including collagenases, such as MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9 , MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19. It interacts with MMP2 through its C-terminal region, specifically targets the C-terminal PEX domain and inhibits MMP2 activity. TIMP-2 Protein, Human (HEK293, His) is the recombinant human-derived TIMP-2 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

TIMP-2 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/timp-2-protein-human-hek-293-his.html

Purity

99.90

Smiles

CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Molecular Formula

7077 (Gene_ID) P16035 (C27-P220) (Accession)

Molecular Weight

23-26 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPD2 (FITC)
564011-01 50 µg

GPD2 (FITC)

Sign In for Pricing
View Details
GPD2 (FITC)
564011-02 100 µg

GPD2 (FITC)

Sign In for Pricing
View Details
CAGE1 (Cancer Associated Gene 1 Protein) BioAssayTM ELISA Kit (Human) discontinued
519164 96 Tests

CAGE1 (Cancer Associated Gene 1 Protein) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
BMP2 Monoclonal Antibody
bsm-0514M 100 µL

BMP2 Monoclonal Antibody

Sign In for Pricing
View Details
Dishevelled 2 (DVL2) Human Gene Knockout Kit (CRISPR)
KN402233 1 Kit

Dishevelled 2 (DVL2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Monoclonal Siglec-10 Antibody (SIGLEC10/7583) [DyLight 488]
NBP3-27040G 0.1 mL

Mouse Monoclonal Siglec-10 Antibody (SIGLEC10/7583) [DyLight 488]

Sign In for Pricing
View Details