Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein PRRC1 (PRRC1)

Product Specifications

Product Name Alternative

Proline-rich and coiled-coil-containing protein 1

Abbreviation

Recombinant Human PRRC1 protein

Gene Name

PRRC1

UniProt

Q96M27

Expression Region

1-445aa

Organism

Homo sapiens (Human)

Target Sequence

MMEESGIETTPPGTPPPNPAGLAATAMSSTPVPLAATSSFSSPNVSSMESFPPLAYSTPQPPLPPVRPSAPLPFVPPPAVPSVPPLVTSMPPPVSPSTAAAFGNPPVSHFPPSTSAPNTLLPAPPSGPPISGFSVGSTYDITRGHAGRAPQTPLMPSFSAPSGTGLLPTPITQQASLTSLAQGTGTTSAITFPEEQEDPRITRGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESMITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPVGYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIHLETFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMSRRQMIYSAARAIAGMYKQRLPPRTV

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

Developed Protein

Source

E.coli

Field of Research

Cell Biology

Relevance

May act as a regulator of the protein kinase A (PKA) activity during embryonic development.

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

51.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNIP3 Recombinant Antibody, FITC Conjugated
bsm-61440R-FITC-01 20 µL

BNIP3 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
BNIP3 Recombinant Antibody, FITC Conjugated
bsm-61440R-FITC-02 100 µL

BNIP3 Recombinant Antibody, FITC Conjugated

Sign In for Pricing
View Details
pCDNA3.1-SNAP29-3XMyc-SV40-Neo Plasmid
PVT33312 2 µg

pCDNA3.1-SNAP29-3XMyc-SV40-Neo Plasmid

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2050888-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2050888-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)
MBS2050888-03 0.5 mL

APC/CY7-Linked Polyclonal Antibody to Integrin Beta 1 (ITGb1)

Sign In for Pricing
View Details