Question 1

What is the catalog number for PAPD5 Protein Vector (Mouse) (pPB-C-His)?

Accepted Answer

The catalog number for PAPD5 Protein Vector (Mouse) (pPB-C-His) is PV213418.

Question 2

Is PAPD5 Protein Vector (Mouse) (pPB-C-His) in stock?

Accepted Answer

PAPD5 Protein Vector (Mouse) (pPB-C-His) is currently made to order / not held in immediate stock. Contact us for lead time.

Question 3

How should this product be stored?

Accepted Answer

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Question 4

Is this product animal-origin-free?

Accepted Answer

Animal-origin-free status, where applicable, is noted on the datasheet under formulation details.

Question 5

Does this product need any special customs documentation to be imported to my country?

Accepted Answer

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

PAPD5 Protein Vector (Mouse) (pPB-C-His)

Product Specifications

Frequently Asked Questions

Explore Other Products

Anti-PSD2 Antibody Picoband®, FITC Conjugate

Leptin Receptor (OBR, LEPR, B219, Obese Receptor) (Not for Export EU)

FITC Anti-Rat CD45 Antibody[OX-1]

FITC Anti-Rat CD45 Antibody[OX-1]

FITC Anti-Rat CD45 Antibody[OX-1]

Peptide Sequence (MLSKTVAPPQQARVSRKAIRAVPMMKNVNEGKGLFAPLVVVTRNIVGKKRFNQLRGKAIALHSQVITEFCKSIGADAKQRQGLIRLAKKNGERLGFLA)