Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Thymosin beta-4 (TMSB4X) (Active)

Product Specifications

Product Name Alternative

T beta-4

Abbreviation

Recombinant Human TMSB4X protein (Active)

Gene Name

TMSB4X

UniProt

P62328

Expression Region

2-44aa

Organism

Homo sapiens (Human)

Target Sequence

SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Signal Transduction

Relevance

Plays an important role in the organization of the cytoskeleton (By similarity) . Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization. {ECO:0000250}.; Seraspenide inhibits the entry of hematopoietic pluripotent stem cells into the S-phase. {ECO:0000250}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>97% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The biological activity determined by its ability to produce a protective effect against hydrogen peroxide in primary lung fibroblasts is in a concentration range of 0.5 - 10 μg/ml.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered concentrated solution in 20 mM PB, pH 7.4.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Plays an important role in the organization of the cytoskeleton (By similarity) . Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.

Molecular Weight

4.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGS14 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
39471154 3x 1.0 µg DNA

RGS14 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
His-Tag (6-Histidine, 6 His, 6-His Epitope Tag, HHHHHH Epitope Tag, HHHHHH Tag, Polyhistidine Tag) (MaxLight 650)
MBS6256015-01 0.1 mL

His-Tag (6-Histidine, 6 His, 6-His Epitope Tag, HHHHHH Epitope Tag, HHHHHH Tag, Polyhistidine Tag) (MaxLight 650)

Sign In for Pricing
View Details
His-Tag (6-Histidine, 6 His, 6-His Epitope Tag, HHHHHH Epitope Tag, HHHHHH Tag, Polyhistidine Tag) (MaxLight 650)
MBS6256015-02 5x 0.1 mL

His-Tag (6-Histidine, 6 His, 6-His Epitope Tag, HHHHHH Epitope Tag, HHHHHH Tag, Polyhistidine Tag) (MaxLight 650)

Sign In for Pricing
View Details
FGFBP3 Human qPCR Template Standard (NM_152429)
HK211892 1 Kit

FGFBP3 Human qPCR Template Standard (NM_152429)

Sign In for Pricing
View Details
GLUT4 Rabbit pAb
MBS9148639-01 0.02 mL

GLUT4 Rabbit pAb

Sign In for Pricing
View Details
GLUT4 Rabbit pAb
MBS9148639-02 0.1 mL

GLUT4 Rabbit pAb

Sign In for Pricing
View Details