Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Apolipoprotein A-I/APOA1, Human (HEK293, His)

Apolipoprotein A-I Protein, Human (HEK293, His) expresses in HEK293 with a His tag at the N-terminus. Apolipoprotein A-I (ApoA-I), the major protein component in high-density lipoprotein (HDL), plays key roles in the Reverse Cholesterol Transport pathway. Apolipoprotein A-I is associated with dengue virus (DV) particles and enhances virus infection through SR-BI[1][2][3].

Product Specifications

Product Name Alternative

Apolipoprotein A-I/APOA1 Protein, Human (HEK293, His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/apolipoprotein-a-i-protein-human-hek293-his.html

Purity

98.0

Smiles

RHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQHHHHHH

Molecular Formula

335 (Gene_ID) P02647 (R19-Q267) (Accession)

Molecular Weight

Approximately 29 kDa

References & Citations

[1]Ikon N, et al. A facile method for isolation of recombinant human apolipoprotein A-I from E. coli. Protein Expr Purif. 2017 Jun;134:18-24.|[2]Obici L, et al. Structure, function and amyloidogenic propensity of apolipoprotein A-I. Amyloid. 2006 Dec;13 (4) :191-205.|[3]Li Y, et al. Human apolipoprotein A-I is associated with dengue virus and enhances virus infection through SR-BI. PLoS One. 2013 Jul 24;8 (7) :e70390.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MATH1 Polyclonal Antibody
bs-3522R 100 µL

MATH1 Polyclonal Antibody

Sign In for Pricing
View Details
PerCP/Fire™ 780 anti-mouse CD335 (NKp46)
GT04187 25 µg

PerCP/Fire™ 780 anti-mouse CD335 (NKp46)

Sign In for Pricing
View Details
50 mL serological pipet, 0.5 mL graduations, standard tip, individually wrapped, sterile, 100/case
5676-8180 100/CS

50 mL serological pipet, 0.5 mL graduations, standard tip, individually wrapped, sterile, 100/case

Sign In for Pricing
View Details
Gap Junction Protein Gamma 2 (GJC2) Antibody
abx241655-01 50 µL

Gap Junction Protein Gamma 2 (GJC2) Antibody

Sign In for Pricing
View Details
Gap Junction Protein Gamma 2 (GJC2) Antibody
abx241655-02 100 µL

Gap Junction Protein Gamma 2 (GJC2) Antibody

Sign In for Pricing
View Details
Anti-G9A Antibody
MBS8247363-01 0.03 mL

Anti-G9A Antibody

Sign In for Pricing
View Details