TGF beta 1/TGFB1, Mouse/Rat (HEK293)
TGF beta 1/TGFB1 Protein belongs to the TGF-β superfamily. TGF beta 1/TGFB1 Protein plays a key role in various physiological and pathological processes such as cell growth, differentiation, apoptosis, immune regulation, and extracellular matrix formation. TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293) is a recombinant TGF beta 1/TGFB1 Protein expressed by HEK293 without a tag[1][2][3].
Product Specifications
Product Name Alternative
TGF beta 1/TGFB1 Protein, Mouse/Rat (HEK293), Rat; Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/tgf-beta-1-tgfb1-protein-mouse-rat-hek293.html
Purity
98.0
Smiles
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
Molecular Formula
21803/59086 (Gene_ID) P04202/P17246 (A279-S390) (Accession)
Molecular Weight
Approximately 13 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
Explore Other Products
Browse additional items from our catalog
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
Recombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
Recombinant Glial Fibrillary Acidic Protein (GFAP)
Recombinant Glial Fibrillary Acidic Protein (GFAP)