Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DKK-1, Mouse (HEK293, His)

DKK-1 protein antagonizes canonical Wnt signaling by inhibiting LRP5/6-Wnt interaction and forming a ternary complex with KREMEN, thereby promoting LRP5/6 internalization. In addition to its Wnt-dependent role, DKK1 has Wnt-independent anti-apoptotic activity by inhibiting the pro-apoptotic function of KREMEN1. DKK-1 Protein, Mouse (HEK293, His) is the recombinant mouse-derived DKK1 protein, expressed by HEK293 , with C-His labeled tag.

Product Specifications

Product Name Alternative

DKK-1 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/dkk1-protein-mouse-hek293-his.html

Purity

98.0

Smiles

TLNSVLINSNAIKNLPPPLGGAGGQPGSAVSVAPGVLYEGGNKYQTLDNYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQICLACRKRRKRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYHTKGQEGSVCLRSSDCAAGLCCARHFWSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYCGEGLACRIQKDHHQASNSSRLHTCQRH

Molecular Formula

13380 (Gene_ID) O54908 (T32-H272) (Accession)

Molecular Weight

Approximately 38.29 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Selectin, Endothelium (SELE) ELISA Kit
RD-SELE-b-48Tests 48 Tests

Bovine Selectin, Endothelium (SELE) ELISA Kit

Sign In for Pricing
View Details
Borrelia Burgdorferi Outer Surface Protein A Recombinant
rAP-5107 1 Each

Borrelia Burgdorferi Outer Surface Protein A Recombinant

Sign In for Pricing
View Details
Nuclear Factor Kappa B2 (NFkB2), Recombinant, Chicken, His-Tag
057773-01 10 µg

Nuclear Factor Kappa B2 (NFkB2), Recombinant, Chicken, His-Tag

Sign In for Pricing
View Details
Nuclear Factor Kappa B2 (NFkB2), Recombinant, Chicken, His-Tag
057773-02 50 µg

Nuclear Factor Kappa B2 (NFkB2), Recombinant, Chicken, His-Tag

Sign In for Pricing
View Details
Nuclear Factor Kappa B2 (NFkB2), Recombinant, Chicken, His-Tag
057773-03 100 µg

Nuclear Factor Kappa B2 (NFkB2), Recombinant, Chicken, His-Tag

Sign In for Pricing
View Details
Nuclear Factor Kappa B2 (NFkB2), Recombinant, Chicken, His-Tag
057773-04 200 µg

Nuclear Factor Kappa B2 (NFkB2), Recombinant, Chicken, His-Tag

Sign In for Pricing
View Details