Siglec-10, Mouse (HEK293, Fc)
Siglec-10 protein is an adhesion molecule that mediates sialic acid-dependent cell binding, preferentially selecting α-2,3- or α-2,6-linked sialic acid. Its sialic acid recognition site may be masked through cis interactions. Siglec-10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Siglec-10 protein, expressed by HEK293 , with C-hFc labeled tag.
Product Specifications
Product Name Alternative
Siglec-10 Protein, Mouse (HEK293, Fc), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/siglec-10-protein-mouse-hek-293-fc.html
Purity
98.0
Smiles
MESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK
Molecular Formula
243958 (Gene_ID) Q80ZE3 (M19-K543) (Accession)
Molecular Weight
110-135 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400030-500 1x 500 µL
Insulin (2D11-H5), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940158-500 1x 500 µL
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 