Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-10, Mouse (HEK293, Fc)

Siglec-10 protein is an adhesion molecule that mediates sialic acid-dependent cell binding, preferentially selecting α-2,3- or α-2,6-linked sialic acid. Its sialic acid recognition site may be masked through cis interactions. Siglec-10 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived Siglec-10 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-10 Protein, Mouse (HEK293, Fc), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-10-protein-mouse-hek-293-fc.html

Purity

98.0

Smiles

MESYFLQVQRIVKAQEGLCIFVPCSFSSPEGKWLNRSPLYGYWFKGIRKPSLSFPVATNNKDKVLEWEARGRFQLLGDISKKNCSLLIKDVQWGDSTNYFFRMERGFERFSFKEEFRLQVEALTQKPDIFIPEVLEPGEPVTVVCLFSWTFNQCPAPSFSWMGDAVSFQESRPHTSNYSVLSFIPGLQHHDTELTCQLDFSRMSTQRTVRLRVAYAPRSLAISIFHDNVSVPDLHENPSHLEVQQGQSLRLLCTADSQPPATLSWVLEDQVLSWSSPVGSRTLALELPWVKAGDSGHYTCQAENRLGSQQHTLDLSVLYPPQDLRVTVSQANRTVLEILRNAISLPVLEGQSLCLVCVTYSNPPANVSWAWVTQTLIPIQSSEPGVLELPLVQREHEGEFTCAAQNPLGAQRISLSLSVHYPPQMSSPSCSWEAKGLHCNCSSRAWPAPSLRWRLGEGLLEGNSSNASFTVTFSSLGPWVNSSLSLLQELGPSLWLSCESWNTHGAQTTSVLLLPDKDSATAFSK

Molecular Formula

243958 (Gene_ID) Q80ZE3 (M19-K543) (Accession)

Molecular Weight

110-135 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TMED7 shRNA Plasmid
abx959455-01 150 µg

Human TMED7 shRNA Plasmid

Sign In for Pricing
View Details
Human TMED7 shRNA Plasmid
abx959455-02 300 µg

Human TMED7 shRNA Plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal Fas/TNFRSF6/CD95 Antibody
NB120-13550 0.1 mg

Rabbit Polyclonal Fas/TNFRSF6/CD95 Antibody

Sign In for Pricing
View Details
Amyloid-β (Aβ1-42) Protein
orb372210 100 µg

Amyloid-β (Aβ1-42) Protein

Sign In for Pricing
View Details
Anti-SLFN11 Antibody
MBS1753787-01 0.01 mg

Anti-SLFN11 Antibody

Sign In for Pricing
View Details
Anti-SLFN11 Antibody
MBS1753787-02 0.1 mg (Carrier Free)

Anti-SLFN11 Antibody

Sign In for Pricing
View Details