Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FANK1 Protein Vector (Mouse) (pPB-N-His)
PV178327 500 ng

FANK1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Prpf31 (NM_001106219) Rat Tagged ORF Clone Lentiviral Particle
RR201237L4V 200 µL

Prpf31 (NM_001106219) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
N4BP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2786308 1.0 µg DNA

N4BP3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
TXNDC1 Double Nickase Plasmid (m2)
sc-428426-NIC-2 20 µg

TXNDC1 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
CLN6 (NM_017882) Human 3' UTR Clone
SC212864 10 µg

CLN6 (NM_017882) Human 3' UTR Clone

Sign In for Pricing
View Details
Amy2a2 Protein Vector (Mouse) (pPB-N-His)
PV154215 500 ng

Amy2a2 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details