Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tribromonitromethane
290285-01 100 mg

Tribromonitromethane

Sign In for Pricing
View Details
Tribromonitromethane
290285-02 250 mg

Tribromonitromethane

Sign In for Pricing
View Details
Olr390 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7141708 1.0 µg DNA

Olr390 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
DHCR24, NT (24-dehydrocholesterol Reductase, 3-beta-hydroxysterol delta-24-reductase, Seladin-1, Diminuto/Dwarf1 Homolog, DHCR24, KIAA0018) (PE) discontinued
D3224-80-PE 200 µL

DHCR24, NT (24-dehydrocholesterol Reductase, 3-beta-hydroxysterol delta-24-reductase, Seladin-1, Diminuto/Dwarf1 Homolog, DHCR24, KIAA0018) (PE) discontinued

Sign In for Pricing
View Details
PKC epsilon, NT (Protein Kinase C, epsilon Type, nPKC-epsilon, PRKCE, PKCE) (MaxLight 650)
MBS6495155-01 0.1 mL

PKC epsilon, NT (Protein Kinase C, epsilon Type, nPKC-epsilon, PRKCE, PKCE) (MaxLight 650)

Sign In for Pricing
View Details
PKC epsilon, NT (Protein Kinase C, epsilon Type, nPKC-epsilon, PRKCE, PKCE) (MaxLight 650)
MBS6495155-02 5x 0.1 mL

PKC epsilon, NT (Protein Kinase C, epsilon Type, nPKC-epsilon, PRKCE, PKCE) (MaxLight 650)

Sign In for Pricing
View Details