Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal CKS2 Antibody (aa1-50)
APR02873G 0.05ml

Polyclonal CKS2 Antibody (aa1-50)

Sign In for Pricing
View Details
FKBP4 AAV Vector (Human) (CMV)
20586101 1 µg

FKBP4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Fam84b (NM_001162926) Mouse Tagged ORF Clone Lentiviral Particle
MR215171L4V 200 µL

Fam84b (NM_001162926) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Human TLN2 Knockout HEK293T cell line
GTR15422776 1 Vial

Human TLN2 Knockout HEK293T cell line

Sign In for Pricing
View Details
Retinol binding Protein 5, cellular
332470 100 µL

Retinol binding Protein 5, cellular

Sign In for Pricing
View Details
C14orf129 (Chromosome 14 Open Reading Frame 129, GSKIP, HSPC210, MGC4945) (APC)
MBS6169870-01 0.1 mL

C14orf129 (Chromosome 14 Open Reading Frame 129, GSKIP, HSPC210, MGC4945) (APC)

Sign In for Pricing
View Details