Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Presenilin 2 (PSEN2) Antibody
abx318829-01 20 µg

Presenilin 2 (PSEN2) Antibody

Sign In for Pricing
View Details
Presenilin 2 (PSEN2) Antibody
abx318829-02 50 µg

Presenilin 2 (PSEN2) Antibody

Sign In for Pricing
View Details
Presenilin 2 (PSEN2) Antibody
abx318829-03 100 µg

Presenilin 2 (PSEN2) Antibody

Sign In for Pricing
View Details
Presenilin 2 (PSEN2) Antibody
abx318829-04 200 µg

Presenilin 2 (PSEN2) Antibody

Sign In for Pricing
View Details
Presenilin 2 (PSEN2) Antibody
abx318829-05 1 mg

Presenilin 2 (PSEN2) Antibody

Sign In for Pricing
View Details
TASP1 CRISPRa sgRNA lentivector (set of three targets)(Human)
46212121 3x 1.0µg DNA

TASP1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details