Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcription initiation Factor TFIID subunit 12 (TAF12) Mouse ELISA Kit
H7463 96 Tests

Transcription initiation Factor TFIID subunit 12 (TAF12) Mouse ELISA Kit

Sign In for Pricing
View Details
Rat Slc40a1 Pre-designed siRNA Set B
SI213173B 1 Each

Rat Slc40a1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CDC2 (Cell Division Control Protein 2 Homolog, CDC28A, Cell Division Protein Kinase 1, Cyclin-dependent Kinase 1, CDK1, p34 Protein Kinase, P34CDC2) (MaxLight 490)
124729-ML490 100 µL

CDC2 (Cell Division Control Protein 2 Homolog, CDC28A, Cell Division Protein Kinase 1, Cyclin-dependent Kinase 1, CDK1, p34 Protein Kinase, P34CDC2) (MaxLight 490)

Sign In for Pricing
View Details
Mouse CHRM3 (Muscarinic acetylcholine receptor M3) ELISA Kit
EM2246 96 Tests

Mouse CHRM3 (Muscarinic acetylcholine receptor M3) ELISA Kit

Sign In for Pricing
View Details
FGFR-3 alpha (IIIb), Mouse (Biotinylated, HEK293, His)
HY-P703984 1 Each

FGFR-3 alpha (IIIb), Mouse (Biotinylated, HEK293, His)

Sign In for Pricing
View Details
FCRL1 Polyclonal Antibody
MBS8531509-01 0.1 mg

FCRL1 Polyclonal Antibody

Sign In for Pricing
View Details