Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PI3 Kinase p110 delta Recombinant Antibody, Cy5.5 Conjugated
bsm-61070R-Cy5.5 100 µL

PI3 Kinase p110 delta Recombinant Antibody, Cy5.5 Conjugated

Sign In for Pricing
View Details
GPN1 rabbit pAb
UB-GEN-12134 100 µL

GPN1 rabbit pAb

Sign In for Pricing
View Details
Livin (BIRC7) Human shRNA Plasmid Kit (Locus ID 79444)
TL306394 1 Kit

Livin (BIRC7) Human shRNA Plasmid Kit (Locus ID 79444)

Sign In for Pricing
View Details
HNF 4 alpha   monoclonal antibody
MB12069 50ul

HNF 4 alpha monoclonal antibody

Sign In for Pricing
View Details
Recombinant Mouse T-cell ecto-ADP-ribosyltransferase 2 (Art2b)
MBS1063157-01 0.02 mg (E-Coli)

Recombinant Mouse T-cell ecto-ADP-ribosyltransferase 2 (Art2b)

Sign In for Pricing
View Details
Recombinant Mouse T-cell ecto-ADP-ribosyltransferase 2 (Art2b)
MBS1063157-02 0.1 mg (E-Coli)

Recombinant Mouse T-cell ecto-ADP-ribosyltransferase 2 (Art2b)

Sign In for Pricing
View Details