Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ITFG1 Antibody (936213) [Janelia Fluor 669]
FAB89001JF669 0.1 mL

Mouse Monoclonal ITFG1 Antibody (936213) [Janelia Fluor 669]

Sign In for Pricing
View Details
Bone Morphogenetic Protein 7 (BMP-7) Monkey ELISA Kit
B9012 96 Tests

Bone Morphogenetic Protein 7 (BMP-7) Monkey ELISA Kit

Sign In for Pricing
View Details
Anti-Human CD153/TNFSF8 Polyclonal Antibody
HW454014-01 50 µg

Anti-Human CD153/TNFSF8 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Human CD153/TNFSF8 Polyclonal Antibody
HW454014-02 100 µg

Anti-Human CD153/TNFSF8 Polyclonal Antibody

Sign In for Pricing
View Details
Rat Monoclonal IRF5 Antibody (903430) [Allophycocyanin]
FAB8447A 0.1 mL

Rat Monoclonal IRF5 Antibody (903430) [Allophycocyanin]

Sign In for Pricing
View Details
CALHM3, NT (CALHM3, FAM26A, Calcium homeostasis modulator protein 3, Protein FAM26A) (MaxLight 490)
MBS6280535-01 0.1 mL

CALHM3, NT (CALHM3, FAM26A, Calcium homeostasis modulator protein 3, Protein FAM26A) (MaxLight 490)

Sign In for Pricing
View Details