Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1orf74 sgRNA CRISPR Lentivector (Human) (Target 1)
K0208002 1.0 µg DNA

C1orf74 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
ATP1A3 Rabbit mAb
RDSA65865 100 µL

ATP1A3 Rabbit mAb

Sign In for Pricing
View Details
Horse Japanese Encephalitis Virus IgM (JE-IgM) ELISA Kit
YLAQ0061HO-01 48 Tests

Horse Japanese Encephalitis Virus IgM (JE-IgM) ELISA Kit

Sign In for Pricing
View Details
Horse Japanese Encephalitis Virus IgM (JE-IgM) ELISA Kit
YLAQ0061HO-02 96 Tests

Horse Japanese Encephalitis Virus IgM (JE-IgM) ELISA Kit

Sign In for Pricing
View Details
LTK, NT (Leukocyte Receptor Tyrosine Kinase, Leukocyte Tyrosine Kinase Receptor, Protein Tyrosine Kinase 1, TYK1) (MaxLight 550) discontinued
L4725-50N-ML550 100 µL

LTK, NT (Leukocyte Receptor Tyrosine Kinase, Leukocyte Tyrosine Kinase Receptor, Protein Tyrosine Kinase 1, TYK1) (MaxLight 550) discontinued

Sign In for Pricing
View Details
FADS1 Rabbit Polyclonal Antibody
E53P12119 100 µL

FADS1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details