Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Qk Protein Vector (Mouse) (pPM-C-HA)
38264024 500 ng

Qk Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
TRNAD5 sgRNA CRISPR Lentivector (Human) (Target 1)
K2480402 1.0 µg DNA

TRNAD5 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Rabbit Monoclonal EphB1 Antibody (022) [DyLight 488]
NBP2-90032G 0.1 mL

Rabbit Monoclonal EphB1 Antibody (022) [DyLight 488]

Sign In for Pricing
View Details
Rel-Biotin-PEG3-C3-NH2
HY-140902 1 Each

Rel-Biotin-PEG3-C3-NH2

Sign In for Pricing
View Details
Stathmin-3 Rabbit Polyclonal Antibody
APRab18372-01 20 µL

Stathmin-3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Stathmin-3 Rabbit Polyclonal Antibody
APRab18372-02 50 µL

Stathmin-3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details