Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

KLP1 (NAT14, N-acetyltransferase 14, K562 Cell-derived Leucine-zipper-like Protein 1) (MaxLight 750)
MBS6233586-01 0.1 mL

KLP1 (NAT14, N-acetyltransferase 14, K562 Cell-derived Leucine-zipper-like Protein 1) (MaxLight 750)

Sign In for Pricing
View Details
KLP1 (NAT14, N-acetyltransferase 14, K562 Cell-derived Leucine-zipper-like Protein 1) (MaxLight 750)
MBS6233586-02 5x 0.1 mL

KLP1 (NAT14, N-acetyltransferase 14, K562 Cell-derived Leucine-zipper-like Protein 1) (MaxLight 750)

Sign In for Pricing
View Details
TUFT1 cDNA Clone
MBS1266723-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

TUFT1 cDNA Clone

Sign In for Pricing
View Details
TUFT1 cDNA Clone
MBS1266723-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

TUFT1 cDNA Clone

Sign In for Pricing
View Details
Pesticide Standards Mixture, 15 components, 100ug/ml each with Chlorothalonil and Dieldrin in Acetone
F263563 1 mL

Pesticide Standards Mixture, 15 components, 100ug/ml each with Chlorothalonil and Dieldrin in Acetone

Sign In for Pricing
View Details
Gykl1 Mouse shRNA Lentiviral Particle (Locus ID 14625)
TL510531V 500 µL Each

Gykl1 Mouse shRNA Lentiviral Particle (Locus ID 14625)

Sign In for Pricing
View Details