Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRRC1 cDNA Clone
MBS1272723-01 0.01 mg Plasmid + 0.2 mL Glycerol-Stock

PRRC1 cDNA Clone

Sign In for Pricing
View Details
PRRC1 cDNA Clone
MBS1272723-02 5x 0.01 mg Plasmid + 5x 0.2 mL Glycerol-Stock

PRRC1 cDNA Clone

Sign In for Pricing
View Details
Human Carbonic Anhydrase 1 (CA1) AssayLite™ Antibody (FITC Conjugate)
33391-05141 2x 75 µg

Human Carbonic Anhydrase 1 (CA1) AssayLite™ Antibody (FITC Conjugate)

Sign In for Pricing
View Details
Aquaporin 4 Mouse mAb
BF9104 100 µL

Aquaporin 4 Mouse mAb

Sign In for Pricing
View Details
IL4I1 Antibody, Biotin conjugated
A64972-50UG 50 µg

IL4I1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SHPRH Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F3]
TA501444AM 100 µL

SHPRH Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F3]

Sign In for Pricing
View Details