Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDPCP Human qPCR Primer Pair (NM_015910)
HP231445 200 Reactions

WDPCP Human qPCR Primer Pair (NM_015910)

Sign In for Pricing
View Details
Slc8b1 Mouse siRNA Oligo Duplex (Locus ID 170756)
SR417216 1 Kit

Slc8b1 Mouse siRNA Oligo Duplex (Locus ID 170756)

Sign In for Pricing
View Details
Human TMM26 ELISA Kit
E106109 1 Each

Human TMM26 ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal TNF-alpha Antibody (6N1E7) [mFluor Violet 500 SE]
NBP2-27224MFV500 0.1 mL

Mouse Monoclonal TNF-alpha Antibody (6N1E7) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
2-Amino-3,3,3-trifluoro-1-propanol
TRC-A630840-1G 1 g

2-Amino-3,3,3-trifluoro-1-propanol

Sign In for Pricing
View Details
Ubiad1 Mouse siRNA Oligo Duplex (Locus ID 71707)
SR411294 1 Kit

Ubiad1 Mouse siRNA Oligo Duplex (Locus ID 71707)

Sign In for Pricing
View Details