Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem132d ORF Vector (Mouse) (pORF)
46890014 1.0 µg DNA

Tmem132d ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Contactin 5/CNTN5 Protein (C-His, Mouse)
P514467 100 µg

Contactin 5/CNTN5 Protein (C-His, Mouse)

Sign In for Pricing
View Details
IGFBP5 protein
30R-2688 25 ug

IGFBP5 protein

Sign In for Pricing
View Details
Human PHTF1 activation kit by CRISPRa
GA107363 1 Kit

Human PHTF1 activation kit by CRISPRa

Sign In for Pricing
View Details
Polyclonal Antibody to Major Histocompatibility Complex Class I C (MHCC)
MBS2026667-01 0.1 mL

Polyclonal Antibody to Major Histocompatibility Complex Class I C (MHCC)

Sign In for Pricing
View Details
Polyclonal Antibody to Major Histocompatibility Complex Class I C (MHCC)
MBS2026667-02 0.2 mL

Polyclonal Antibody to Major Histocompatibility Complex Class I C (MHCC)

Sign In for Pricing
View Details