Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TRIM33 Antibody
ANT-36446-100ug 100 µg

Human TRIM33 Antibody

Sign In for Pricing
View Details
ADRB3 (ADRB3, Adrenoceptor beta 3, ADRB3R, Adrenaline beta 3 Receptor, Adrenergic, beta-3-, Receptor, Beta-3 Adrenergic Receptor, B3AR, Beta-3 adrenoceptor, Beta3-AR, Beta-3 AdrenoReceptor, BETA3AR)
170162 50 µg

ADRB3 (ADRB3, Adrenoceptor beta 3, ADRB3R, Adrenaline beta 3 Receptor, Adrenergic, beta-3-, Receptor, Beta-3 Adrenergic Receptor, B3AR, Beta-3 adrenoceptor, Beta3-AR, Beta-3 AdrenoReceptor, BETA3AR)

Sign In for Pricing
View Details
CPNE2 siRNA (Human)
CRJ6496-01 15 nmol

CPNE2 siRNA (Human)

Sign In for Pricing
View Details
CPNE2 siRNA (Human)
CRJ6496-02 30 nmol

CPNE2 siRNA (Human)

Sign In for Pricing
View Details
Oct4 (POU5F1) CytoSection
TS411998P5 25 Slides

Oct4 (POU5F1) CytoSection

Sign In for Pricing
View Details
NAGLU CRISPR Activation Plasmid (h)
sc-410893-ACT 20 µg

NAGLU CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details