Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM10A3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0714507 1.0 µg DNA

FAM10A3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lentiviral human CCDC78 shRNA (UAS) - Lentiviral human CCDC78 shRNA (UAS, iRFP) (25)
GTR15319793 1 Vial

Lentiviral human CCDC78 shRNA (UAS) - Lentiviral human CCDC78 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
PKC delta Recombinant Antibody, AbBy Fluor™ 680 Conjugated
bsm-52773R-BF680 100 µL

PKC delta Recombinant Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Recombinant Pig CSF2/GM-CSF Protein, N-His
E55P4132 50 µg

Recombinant Pig CSF2/GM-CSF Protein, N-His

Sign In for Pricing
View Details
Vmn1r65-set siRNA/shRNA/RNAi Lentivector (Mouse)
49693094 4x 500 ng

Vmn1r65-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
ZAP70 Mouse mAb
E47M51603 100 µL

ZAP70 Mouse mAb

Sign In for Pricing
View Details