Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cathepsin A, Mouse (HEK293, His)

Cathepsin A, a multifunctional protein, crucially supports beta-galactosidase and neuraminidase activities.It forms protective associations with these enzymes, ensuring their stability and overall function.Cathepsin A also displays carboxypeptidase activity and the ability to deamidate tachykinins, highlighting its diverse enzymatic functions.Cathepsin A Protein, Mouse (HEK293, His) is the recombinant mouse-derived Cathepsin A protein, expressed by HEK293 , with C-10*His labeled tag.

Product Specifications

Product Name Alternative

Cathepsin A Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cathepsin-a-protein-mouse-hek293-his.html

Purity

95.0

Smiles

APDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY

Molecular Formula

19025 (Gene_ID) P16675 (A24-Y474) (Accession)

Molecular Weight

Approximately 52.8 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL
BNC470026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL
BNC470630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF405S conjugate, 0.1mg/mL
BNC041960-500 1x 500 µL

GAD2 / GAD65 (GABAergic Neuronal Marker) (GAD2/1960), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PSA (Prostate Specific Antigen) (A67-B/E3), CF488A conjugate, 0.1mg/mL
BNC880883-100 1x 100 µL

PSA (Prostate Specific Antigen) (A67-B/E3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF594 conjugate, 0.1mg/mL
BNC941574-100 1x 100 µL

HIF1 alpha (Hypoxia-Inducible Factor 1-alpha) (ESEE122), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF640R conjugate, 0.1mg/mL
BNC402329-100 1x 100 µL

MyoD1 (Rhabdomyosarcoma Marker) (rMYD712), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details