Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-9, Mouse (CHO, His)

IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family.IL-9 Protein, Mouse (CHO, His) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma.

Product Specifications

Product Name Alternative

IL-9 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-9-protein-mouse-cho.html

Purity

95.0

Smiles

QRCSTTWGIRDTNYLIENKLDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

Molecular Formula

16198 (Gene_ID) P15247 (Q19-P144) (Accession)

Molecular Weight

Approximately 28-42 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Miyazawa K, et al. Recombinant human interleukin-9 induces protein tyrosine phosphorylation and synergizes with steel factor to stimulate proliferation of the human factor-dependent cell line, M07e. Blood. 1992 Oct 1;80 (7) :1685-92.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ppp1r11 (BC027737) Mouse Tagged ORF Clone
MG200757 10 µg

Ppp1r11 (BC027737) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
MMP13 (NM_002427) Human Recombinant Protein
TP324156 20 µg

MMP13 (NM_002427) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse Folr2 activation kit by CRISPRa
GA201462 1 Kit

Mouse Folr2 activation kit by CRISPRa

Sign In for Pricing
View Details
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), Biotin conjugate, 0.1mg/mL
BNCB3124-100 1x 100 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/3124R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS633328 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Guvacine Hydrochloride
TRC-G876400-25MG 25 mg

Guvacine Hydrochloride

Sign In for Pricing
View Details