Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-9, Mouse (CHO, His)

IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family.IL-9 Protein, Mouse (CHO, His) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma.

Product Specifications

Product Name Alternative

IL-9 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-9-protein-mouse-cho.html

Purity

95.0

Smiles

QRCSTTWGIRDTNYLIENKLDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

Molecular Formula

16198 (Gene_ID) P15247 (Q19-P144) (Accession)

Molecular Weight

Approximately 28-42 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Miyazawa K, et al. Recombinant human interleukin-9 induces protein tyrosine phosphorylation and synergizes with steel factor to stimulate proliferation of the human factor-dependent cell line, M07e. Blood. 1992 Oct 1;80 (7) :1685-92.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (CD68/G2), CF640R conjugate, 0.1mg/mL
BNC400919-100 1x 100 µL

CD68 (CD68/G2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF640R conjugate, 0.1mg/mL
BNC400032-500 1x 500 µL

MUC2 (CCP58), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RBBP9 Human Gene Knockout Kit (CRISPR)
KN402090 1 Kit

RBBP9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fadd Rabbit Polyclonal Antibody
TA376076 100 µL

Fadd Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytochrome P450 Reductase (POR) (NM_000941) Human Over-expression Lysate
LY424436 100 µg

Cytochrome P450 Reductase (POR) (NM_000941) Human Over-expression Lysate

Sign In for Pricing
View Details
TRIM24 Polyclonal Antibody
E-AB-17454-01 20 µL

TRIM24 Polyclonal Antibody

Sign In for Pricing
View Details