Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-9, Mouse (CHO, His)

IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family.IL-9 Protein, Mouse (CHO, His) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma.

Product Specifications

Product Name Alternative

IL-9 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-9-protein-mouse-cho.html

Purity

95.0

Smiles

QRCSTTWGIRDTNYLIENKLDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

Molecular Formula

16198 (Gene_ID) P15247 (Q19-P144) (Accession)

Molecular Weight

Approximately 28-42 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Miyazawa K, et al. Recombinant human interleukin-9 induces protein tyrosine phosphorylation and synergizes with steel factor to stimulate proliferation of the human factor-dependent cell line, M07e. Blood. 1992 Oct 1;80 (7) :1685-92.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD31 (2F7B) Antibody
252704 0.1 mL

CD31 (2F7B) Antibody

Sign In for Pricing
View Details
FUCA1 (Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside Fucohydrolase 1, FUCA, Nbla10230, Tissue alpha-L-fucosidase) (MaxLight 550) discontinued
F9165-50B-ML550 100 µL

FUCA1 (Alpha-L-fucosidase 1, Alpha-L-fucosidase I, Alpha-L-fucoside Fucohydrolase 1, FUCA, Nbla10230, Tissue alpha-L-fucosidase) (MaxLight 550) discontinued

Sign In for Pricing
View Details
YTHDF2 Polyclonal Antibody, Biotin Conjugated
A68193-100 100 µL

YTHDF2 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Human V-type proton ATPase 116 kDa subunit a isoform 2 (ATP6V0A2) Elisa Kit
EK714781 96 Well

Human V-type proton ATPase 116 kDa subunit a isoform 2 (ATP6V0A2) Elisa Kit

Sign In for Pricing
View Details
Lentiviral mouse Taar7f shRNA (UAS) - Lentiviral mouseTaar7f shRNA (UAS, GFP) (25)
GTR15167120 1 Vial

Lentiviral mouse Taar7f shRNA (UAS) - Lentiviral mouseTaar7f shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Mouse Monoclonal DPH2 Antibody (OTI4E7) [PE/Atto594]
NBP2-70585PEATT594 0.1 mL

Mouse Monoclonal DPH2 Antibody (OTI4E7) [PE/Atto594]

Sign In for Pricing
View Details