Biglycan, Human (HEK293, His)
Biglycan Protein, Human (HEK293, His) is a recombinant human Biglycan produced in HEK293 cells with a His tag. Biglycan, a small leucine-rich proteoglycan, acts as a danger signal and is classically thought to promote macrophage recruitment via Toll-like receptors (TLR) 2 and 4[1].
Product Specifications
Product Name Alternative
Biglycan Protein, Human (HEK293, His), Human, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/biglycan-protein-human-hek293-his.html
Purity
98.0
Smiles
EQRGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSLVELRIHDNRIRKVPKGVFSGLRNMNCIEMGGNPLENSGFEPGAFDGLKLNYLRISEAKLTGIPKDLPETLNELHLDHNKIQAIELEDLLRYSKLYRLGLGHNQIRMIENGSLSFLPTLRELHLDNNKLARVPSGLPDLKLLQVVYLHSNNITKVGVNDFCPMGFGVKRAYYNGISLFNNPVPYWEVQPATFRCVTDRLAIQFGNYKKHHHHHH
Molecular Formula
633 (Gene_ID) P21810 (E20-K368) (Accession)
Molecular Weight
Approximately 40-90 kDa, due to the glycosylation.
References & Citations
[1]Wang B, et al. Biglycan expression correlates with aggressiveness and poor prognosis of gastric cancer. Exp Biol Med (Maywood) . 2011;236 (11) :1247-1253.|[2]Poluzzi C, et al. Biglycan evokes autophagy in macrophages via a novel CD44/Toll-like receptor 4 signaling axis in ischemia/reperfusion injury. Kidney Int. 2019;95 (3) :540-562.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680977-500 1x 500 µL
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470204-100 1x 100 µL
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681429-500 1x 500 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details