Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OX40 Ligand/TNFSF4, Rat (HEK293, Fc)

Selected Variant

HY-P74660-01

Size: 2 µg

OX40 Ligand (TNFSF4) is a type II glycoprotein with a cytoplasmic tail of 23 aa and an extracellular domain of 133 aa[1]. OX40 Ligand is a ligand for TNFRSF4 (CD134), belongs to tumor necrosis factor (TNF) family. OX40 Ligand can activate OX40 and thereby functioning as a T cell co-stimulatory molecule. The OX40-OX40 Ligand interaction promotes effector T-cell survival and effectively induces memory T-cell generation, as well as enhances the helper function of Tfh for B cells, and also promotes the differentiation and maturation of DCs[1][2]. OX40 Ligand/TNFSF4 Protein, Rat (HEK293, Fc) is a recombinant rat OX40 Ligand (V20-P210) with C-terminal hFc tag, which is produced in HEK293.

Product Specifications

Product Name Alternative

OX40 Ligand/TNFSF4 Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/ox40-ligand-tnfsf4-protein-rat-hek293-fc.html

Purity

98.0

Smiles

VTVKLNCVKDTYPSGHKCCRECQPGHGMVSRCDHTRDTVCHPCEPGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTEDTVCQCRPGTQPRQDSSHKLGVDCVPCPPGHFSPGSNQACKPWTNCTLSGKQIRHPASNSLDTVCEDRSLLATLLWETQRTTFRPTTVPSTTVWPRTSQLPSTPTLVAPEGP

Molecular Formula

25572 (Gene_ID) P15725 (V20-P210) (Accession)

Molecular Weight

Approximately 65-75 kDa

References & Citations

[1]Kaur D, et al. OX40/OX40 ligand interactions in T-cell regulation and asthma. Chest. 2012 Feb;141 (2) :494-499.|[2]Fu N, et al. The OX40/OX40L Axis Regulates T Follicular Helper Cell Differentiation: Implications for Autoimmune Diseases. Front Immunol. 2021 Jun 21;12:670637. |[3]Croft M, et al. The significance of OX40 and OX40L to T-cell biology and immune disease. Immunol Rev. 2009 May;229 (1) :173-91.|[4]Buglio D, et al. HDAC11 plays an essential role in regulating OX40 ligand expression in Hodgkin lymphoma. Blood. 2011 Mar 10;117 (10) :2910-7|[5]Qiao J, et al. TSLP from RSV-stimulated rat airway epithelial cells activates myeloid dendritic cells. Immunol Cell Biol. 2011 Feb;89 (2) :231-8. |[6]Lei W, et al. Crucial role of OX40/OX40L signaling in a murine model of asthma. Mol Med Rep. 2018 Mar;17 (3) :4213-4220.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Price

Sign In for Pricing

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AIF1 / Iba1 (Microglia Marker) (AIF1/2493), 1mg/mL
BNUM2493-50 1x 50 µL

AIF1 / Iba1 (Microglia Marker) (AIF1/2493), 1mg/mL

Sign In for Pricing
View Details
Anti-CRISPR-Cas9 SP Rabbit Monoclonal Antibody
M30929 100 µL/Vial

Anti-CRISPR-Cas9 SP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Anti-PBP/PEBP1 Antibody Picoband®, FITC Conjugate
PA1713-FITC 100 µg/Vial

Anti-PBP/PEBP1 Antibody Picoband®, FITC Conjugate

Sign In for Pricing
View Details
Anti-Nesprin3/SYNE3 Antibody Picoband® (Dylight488 Conjugate)
A13164-2-Dylight488 100 µg

Anti-Nesprin3/SYNE3 Antibody Picoband® (Dylight488 Conjugate)

Sign In for Pricing
View Details
Chromogranin A (CGA/414), CF740 conjugate, 0.1mg/mL
BNC740414-100 1x 100 µL

Chromogranin A (CGA/414), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycophorin A / CD235a (GYPA/280), CF640R conjugate, 0.1mg/mL
BNC400280-500 1x 500 µL

Glycophorin A / CD235a (GYPA/280), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details