Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

STRN3 Rabbit pAb
A12586 50 µL

STRN3 Rabbit pAb

Sign In for Pricing
View Details
BLNK, ID (B Cell Linker Protein, Cytoplasmic Adapter Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, SLP65, BASH, BLNK)
MBS6465061-01 0.1 mL

BLNK, ID (B Cell Linker Protein, Cytoplasmic Adapter Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, SLP65, BASH, BLNK)

Sign In for Pricing
View Details
BLNK, ID (B Cell Linker Protein, Cytoplasmic Adapter Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, SLP65, BASH, BLNK)
MBS6465061-02 5x 0.1 mL

BLNK, ID (B Cell Linker Protein, Cytoplasmic Adapter Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, SLP65, BASH, BLNK)

Sign In for Pricing
View Details
Porcine Putative Phospholipase B-Like 1 (PLBD1) ELISA Kit
MBS9353635-01 48 Well

Porcine Putative Phospholipase B-Like 1 (PLBD1) ELISA Kit

Sign In for Pricing
View Details
Porcine Putative Phospholipase B-Like 1 (PLBD1) ELISA Kit
MBS9353635-02 96 Well

Porcine Putative Phospholipase B-Like 1 (PLBD1) ELISA Kit

Sign In for Pricing
View Details
Porcine Putative Phospholipase B-Like 1 (PLBD1) ELISA Kit
MBS9353635-03 5x 96 Well

Porcine Putative Phospholipase B-Like 1 (PLBD1) ELISA Kit

Sign In for Pricing
View Details