Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC36A1 Adenovirus (Human)
44158051 1.0 mL

SLC36A1 Adenovirus (Human)

Sign In for Pricing
View Details
ZBTB8B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2661208 1.0 µg DNA

ZBTB8B sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rat PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit
RE1072R-01 48 Tests

Rat PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit

Sign In for Pricing
View Details
Rat PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit
RE1072R-02 96 Tests

Rat PAPPA (Pregnancy Associated Plasma Protein A) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human EAF1 Protein, N-His-SUMO
E55P5687 50 µg

Recombinant Human EAF1 Protein, N-His-SUMO

Sign In for Pricing
View Details
γ- (6-Aminohexyl) -GTP – ATTO-580Q
JBS-NU-834-580Q 80 µL

γ- (6-Aminohexyl) -GTP – ATTO-580Q

Sign In for Pricing
View Details