Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC16B sgRNA CRISPR Lentivector (Human) (Target 1)
K1233202 1.0 µg DNA

LRRC16B sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Ski (G8) PE
sc-33693 PE 200 µg/mL

Ski (G8) PE

Sign In for Pricing
View Details
NUP50 (NM_153645) Human Over-expression Lysate
LC407000 20 µg

NUP50 (NM_153645) Human Over-expression Lysate

Sign In for Pricing
View Details
Scfd2 Mouse Gene Knockout Kit (CRISPR)
KN515354 1 Kit

Scfd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Lentiviral human GDPGP1 shRNA (UAS) - Lentiviral human GDPGP1 shRNA (UAS, GFP) plasmid
GTR15125518 1 Vial

Lentiviral human GDPGP1 shRNA (UAS) - Lentiviral human GDPGP1 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
RNF166 3'UTR GFP Stable Cell Line
TU070084 1.0 mL

RNF166 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details