Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFNAR1 Antibody
A44235-100UG 100 µg

IFNAR1 Antibody

Sign In for Pricing
View Details
Mrps24 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6045604 1.0 µg DNA

Mrps24 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Canine Immunoglobulin M, IgM ELISA Kit
MBS166186-01 48 Well

Canine Immunoglobulin M, IgM ELISA Kit

Sign In for Pricing
View Details
Canine Immunoglobulin M, IgM ELISA Kit
MBS166186-02 96 Well

Canine Immunoglobulin M, IgM ELISA Kit

Sign In for Pricing
View Details
Canine Immunoglobulin M, IgM ELISA Kit
MBS166186-03 5x 96 Well

Canine Immunoglobulin M, IgM ELISA Kit

Sign In for Pricing
View Details
Canine Immunoglobulin M, IgM ELISA Kit
MBS166186-04 10x 96 Well

Canine Immunoglobulin M, IgM ELISA Kit

Sign In for Pricing
View Details