Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1214 sgRNA CRISPR Lentivector (Rat) (Target 1)
K7218102 1.0 µg DNA

Olr1214 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI9G3]
TA805986S 30 µL

Laminin 5 (LAMB3) Mouse Monoclonal Antibody [Clone ID: OTI9G3]

Sign In for Pricing
View Details
Rabbit Polyclonal Respiratory Syncytial Virus Subgroup A G Glycoprotein Antibody [Alexa Fluor 647]
NBP3-18799AF647 0.1 mL

Rabbit Polyclonal Respiratory Syncytial Virus Subgroup A G Glycoprotein Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
CIR1 Polyclonal Antibody
MBS2561555-01 0.02 mL

CIR1 Polyclonal Antibody

Sign In for Pricing
View Details
CIR1 Polyclonal Antibody
MBS2561555-02 0.06 mL

CIR1 Polyclonal Antibody

Sign In for Pricing
View Details
CIR1 Polyclonal Antibody
MBS2561555-03 0.12 mL

CIR1 Polyclonal Antibody

Sign In for Pricing
View Details