Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Integrin alpha-L Protein, His, Yeast-1mg
QP6240-ye-1mg 1mg

Recombinant Mouse Integrin alpha-L Protein, His, Yeast-1mg

Sign In for Pricing
View Details
G0S2 3'UTR GFP Stable Cell Line
TU059358 1.0 mL

G0S2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Ccny (BC023321) AAV Particle
MR205108A1V 250 µL

Mouse Ccny (BC023321) AAV Particle

Sign In for Pricing
View Details
DPRXP7 sgRNA CRISPR Lentivector set (Human)
K0629701 3x 1.0 µg

DPRXP7 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
WAS CRISPR All-in-one AAV vector set (with saCas9)(Human)
50254151 3x 1.0 µg DNA

WAS CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
MPDU1 Protein Vector (Rat) (pPM-C-His)
PV282833 500 ng

MPDU1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details