Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rps2 (NM_008503) Mouse Tagged ORF Clone Lentiviral Particle
MR220544L4V 200 µL

Rps2 (NM_008503) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Anti-CXCR4(ulocuplumab biosimilar) mAb
MBS189314-01 0.05 mg

Anti-CXCR4(ulocuplumab biosimilar) mAb

Sign In for Pricing
View Details
Anti-CXCR4(ulocuplumab biosimilar) mAb
MBS189314-02 0.1 mg

Anti-CXCR4(ulocuplumab biosimilar) mAb

Sign In for Pricing
View Details
Anti-CXCR4(ulocuplumab biosimilar) mAb
MBS189314-03 5x 0.1 mg

Anti-CXCR4(ulocuplumab biosimilar) mAb

Sign In for Pricing
View Details
ACBD3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV667127 1.0 µg DNA

ACBD3 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 8/18 Antibody (SPM141) [Biotin]
NBP3-11564B 0.1 mL

Mouse Monoclonal Cytokeratin 8/18 Antibody (SPM141) [Biotin]

Sign In for Pricing
View Details