Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC13A4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
43882061 1.0 µg DNA

SLC13A4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
H2A Histone Family Member Z (H2AFZ) Antibody
abx026163-01 80 µL

H2A Histone Family Member Z (H2AFZ) Antibody

Sign In for Pricing
View Details
H2A Histone Family Member Z (H2AFZ) Antibody
abx026163-02 400 µL

H2A Histone Family Member Z (H2AFZ) Antibody

Sign In for Pricing
View Details
FIP1L1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV652773 1.0 µg DNA

FIP1L1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse Monoclonal HGFR/c-MET Antibody (17) [DyLight 755]
NBP2-50171IR 0.1 mL

Mouse Monoclonal HGFR/c-MET Antibody (17) [DyLight 755]

Sign In for Pricing
View Details
Mouse Monoclonal CD1a Antibody (C1A/711) [Janelia Fluor 646]
NBP2-34574JF646 0.1 mL

Mouse Monoclonal CD1a Antibody (C1A/711) [Janelia Fluor 646]

Sign In for Pricing
View Details