Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD23 (FCER2) Mouse Monoclonal Antibody [Clone ID: OTI7C9]
CF801555 100 µg

CD23 (FCER2) Mouse Monoclonal Antibody [Clone ID: OTI7C9]

Sign In for Pricing
View Details
CYPOR Recombinant Antibody, PerCP Conjugated
bsm-61747R-PerCP-01 20 µL

CYPOR Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
CYPOR Recombinant Antibody, PerCP Conjugated
bsm-61747R-PerCP-02 100 µL

CYPOR Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Rabbit Polyclonal Aquaporin 1/AQP1 Antibody
NBP2-97583-100ul 100 µL

Rabbit Polyclonal Aquaporin 1/AQP1 Antibody

Sign In for Pricing
View Details
Anti-S6A18 SLC6A18 Antibody
A10812 100 µL

Anti-S6A18 SLC6A18 Antibody

Sign In for Pricing
View Details
Mouse TPM2 shRNA Plasmid
abx973196-01 150 µg

Mouse TPM2 shRNA Plasmid

Sign In for Pricing
View Details