Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASC1 (TRIP4) (NM_016213) Human Tagged ORF Clone Lentiviral Particle
RC201863L4V 200 µL

ASC1 (TRIP4) (NM_016213) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
MAP2K2 Protein Vector (Mouse) (pPB-C-His)
PV198906 500 ng

MAP2K2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rabbit anti-Zygosaccharomyces rouxii (Candida mogii) HOG1 Polyclonal Antibody
MBS7181711 Inquire

Rabbit anti-Zygosaccharomyces rouxii (Candida mogii) HOG1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CDIP Antibody [DyLight 405]
NBP1-76996V 0.1 mL

Rabbit Polyclonal CDIP Antibody [DyLight 405]

Sign In for Pricing
View Details
Anti-Interleukin 12A (IL12A)
FY-AB46557-01 1 mL

Anti-Interleukin 12A (IL12A)

Sign In for Pricing
View Details
Anti-Interleukin 12A (IL12A)
FY-AB46557-02 100 µL

Anti-Interleukin 12A (IL12A)

Sign In for Pricing
View Details