Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr446 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV634557 1.0 µg DNA

Olr446 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Mouse BPIFB2 shRNA Plasmid
abx975671-01 150 µg

Mouse BPIFB2 shRNA Plasmid

Sign In for Pricing
View Details
Mouse BPIFB2 shRNA Plasmid
abx975671-02 300 µg

Mouse BPIFB2 shRNA Plasmid

Sign In for Pricing
View Details
Car5a Mouse shRNA Plasmid (Locus ID 12352)
TR517194 1 Kit

Car5a Mouse shRNA Plasmid (Locus ID 12352)

Sign In for Pricing
View Details
HIPK4, Human (sf9, GST)
HY-P701700 1 Each

HIPK4, Human (sf9, GST)

Sign In for Pricing
View Details
Human NFE2L3 (Nuclear factor erythroid 2-related factor 3) ELISA Kit
MBS7612592-01 48 Well

Human NFE2L3 (Nuclear factor erythroid 2-related factor 3) ELISA Kit

Sign In for Pricing
View Details