Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Platelet basic protein ELISA Kit
EK1093 Inquire

Human Platelet basic protein ELISA Kit

Sign In for Pricing
View Details
SARS-CoV-2 Nucleocapsid protein, His Tag (B.1.1.529/Omicron)
NUN-C52Ht-1mg 1 mg

SARS-CoV-2 Nucleocapsid protein, His Tag (B.1.1.529/Omicron)

Sign In for Pricing
View Details
HAUS4 Protein Vector (Human) (pPB-C-His)
PV082297 500 ng

HAUS4 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
4933433C11Rik CRISPR/Cas9 KO Plasmid (m)
sc-428901 20 µg

4933433C11Rik CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
RPLP2 Antibody
A40612-50UL 50 μL

RPLP2 Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PCDHA10 pAb
PA10759-01 50 μL

Rabbit Anti-Human PCDHA10 pAb

Sign In for Pricing
View Details