Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

anti-SIRT6
YF-PA19117 50 ug

anti-SIRT6

Sign In for Pricing
View Details
Human ASGR1-coupled Magnetic Beads
MBS-K055-10mg 10 mg

Human ASGR1-coupled Magnetic Beads

Sign In for Pricing
View Details
Rat Lias Pre-designed siRNA Set A
SI207610A 1 Each

Rat Lias Pre-designed siRNA Set A

Sign In for Pricing
View Details
AK3L1 (AK4) Human qPCR Primer Pair (NM_013410)
HP231678 200 Reactions

AK3L1 (AK4) Human qPCR Primer Pair (NM_013410)

Sign In for Pricing
View Details
Merestinib (LY2801653)
C12382-01 5 mg

Merestinib (LY2801653)

Sign In for Pricing
View Details
Merestinib (LY2801653)
C12382-02 10 mM / 1 mL

Merestinib (LY2801653)

Sign In for Pricing
View Details