Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,3-Dibutyryl-2-oleoyl glycerol
HY-165051-01 1 mg

1,3-Dibutyryl-2-oleoyl glycerol

Sign In for Pricing
View Details
1,3-Dibutyryl-2-oleoyl glycerol
HY-165051-02 5 mg

1,3-Dibutyryl-2-oleoyl glycerol

Sign In for Pricing
View Details
A33, CT (Cell Surface A33 Antigen, Glycoprotein A33, Glycoprotein A33 (Transmembrane), GPA33, MGC129986, MGC129987) (MaxLight 750)
MBS6460780-01 0.1 mL

A33, CT (Cell Surface A33 Antigen, Glycoprotein A33, Glycoprotein A33 (Transmembrane), GPA33, MGC129986, MGC129987) (MaxLight 750)

Sign In for Pricing
View Details
A33, CT (Cell Surface A33 Antigen, Glycoprotein A33, Glycoprotein A33 (Transmembrane), GPA33, MGC129986, MGC129987) (MaxLight 750)
MBS6460780-02 5x 0.1 mL

A33, CT (Cell Surface A33 Antigen, Glycoprotein A33, Glycoprotein A33 (Transmembrane), GPA33, MGC129986, MGC129987) (MaxLight 750)

Sign In for Pricing
View Details
RPL10 (DXS648E, QM) discontinued
513751 100 µg

RPL10 (DXS648E, QM) discontinued

Sign In for Pricing
View Details
BNIP3 (BCL2 Adenovirus E1B 19kDa Interacting Protein 3, BCL2/adenovirus E1B 19kD Protein Interacting Protein 3, NIP3) (MaxLight 650)
123972-ML650 100 µL

BNIP3 (BCL2 Adenovirus E1B 19kDa Interacting Protein 3, BCL2/adenovirus E1B 19kD Protein Interacting Protein 3, NIP3) (MaxLight 650)

Sign In for Pricing
View Details