Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DARC, NT (DARC, FY, GPD, Duffy antigen/chemokine receptor, Fy glycoprotein, Glycoprotein D, Plasmodium vivax receptor, CD234)
034476 200 µL

DARC, NT (DARC, FY, GPD, Duffy antigen/chemokine receptor, Fy glycoprotein, Glycoprotein D, Plasmodium vivax receptor, CD234)

Sign In for Pricing
View Details
Mouse CYP3A5 (Cytochrome P450 3A5) ELISA Kit
EK248686 96 Well

Mouse CYP3A5 (Cytochrome P450 3A5) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal C3orf39 Antibody
NBP2-34067 0.1 mL

Rabbit Polyclonal C3orf39 Antibody

Sign In for Pricing
View Details
CHEK2 Antibody
ABD6868 100 µg

CHEK2 Antibody

Sign In for Pricing
View Details
TCP-1 Beta Monoclonal Antibody
JOT-MCA1193-01 50ul

TCP-1 Beta Monoclonal Antibody

Sign In for Pricing
View Details
TCP-1 Beta Monoclonal Antibody
JOT-MCA1193-02 100ul

TCP-1 Beta Monoclonal Antibody

Sign In for Pricing
View Details