Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

S-[2- (Iodo-4-azidosalicylamido) ethylthio]-2-thiopyridine
MF-0150363-01 100 mg

S-[2- (Iodo-4-azidosalicylamido) ethylthio]-2-thiopyridine

Sign In for Pricing
View Details
S-[2- (Iodo-4-azidosalicylamido) ethylthio]-2-thiopyridine
MF-0150363-02 250 mg

S-[2- (Iodo-4-azidosalicylamido) ethylthio]-2-thiopyridine

Sign In for Pricing
View Details
S-[2- (Iodo-4-azidosalicylamido) ethylthio]-2-thiopyridine
MF-0150363-03 50 mg

S-[2- (Iodo-4-azidosalicylamido) ethylthio]-2-thiopyridine

Sign In for Pricing
View Details
GFP Protein, Aequorea victoria, Recombinant (His Tag)
PO54681E2 50 µg

GFP Protein, Aequorea victoria, Recombinant (His Tag)

Sign In for Pricing
View Details
DHX32 (Putative Pre-mRNA-splicing Factor ATP-dependent RNA Helicase DHX32, DEAH (Asp-Glu-Ala-His) Box Polypeptide 32)
479342 100 µL

DHX32 (Putative Pre-mRNA-splicing Factor ATP-dependent RNA Helicase DHX32, DEAH (Asp-Glu-Ala-His) Box Polypeptide 32)

Sign In for Pricing
View Details
Recombinant Helicobacter Pylori acpS Protein (aa 1-118)
VAng-Lsx3526-500gEcoli 500 µg (E. coli)

Recombinant Helicobacter Pylori acpS Protein (aa 1-118)

Sign In for Pricing
View Details