Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Hu CD79a APC
MBS1800743-01 100 Tests

Anti-Hu CD79a APC

Sign In for Pricing
View Details
Anti-Hu CD79a APC
MBS1800743-02 5x 100 Tests

Anti-Hu CD79a APC

Sign In for Pricing
View Details
WIT1 Antibody
ABD8816 100 µg

WIT1 Antibody

Sign In for Pricing
View Details
Lentiviral mouse Pp2d1 shRNA (UAS) - Lentiviral mouse Pp2d1 shRNA (UAS, RFP) (25)
GTR15297602 1 Vial

Lentiviral mouse Pp2d1 shRNA (UAS) - Lentiviral mouse Pp2d1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
HSBP1 (Heat Shock Factor-binding Protein 1, Nasopharyngeal Carcinoma-associated Antigen 13, NPC-A-13, HSF1BP) (FITC)
128077-FITC 100 µL

HSBP1 (Heat Shock Factor-binding Protein 1, Nasopharyngeal Carcinoma-associated Antigen 13, NPC-A-13, HSF1BP) (FITC)

Sign In for Pricing
View Details
TMEM165-set siRNA/shRNA/RNAi Lentivector (Human)
46929091 4x 500 ng

TMEM165-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details