Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-RAB12 antibody
STJ116532 100 µl

Anti-RAB12 antibody

Sign In for Pricing
View Details
Bmi1 Mouse qPCR Primer Pair (NM_007552)
MP201350 200 Reactions

Bmi1 Mouse qPCR Primer Pair (NM_007552)

Sign In for Pricing
View Details
ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (MaxLight 405)
MBS6367553-01 0.1 mL

ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (MaxLight 405)

Sign In for Pricing
View Details
ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (MaxLight 405)
MBS6367553-02 5x 0.1 mL

ZNF71, NT (ZNF71, EZFIT, Endothelial zinc finger protein induced by tumor necrosis factor alpha, Zinc finger protein 71) (MaxLight 405)

Sign In for Pricing
View Details
NPY shRNA (m) Lentiviral Particles
sc-42100-V 200 µL

NPY shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
C-RAF (Phospho Tyr340) Antibody
C51088-01 50 μL

C-RAF (Phospho Tyr340) Antibody

Sign In for Pricing
View Details