Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BMP5 (Bone Morphogenetic Protein 5, MGC34244) (MaxLight 650)
243827-ML650 100 µL

BMP5 (Bone Morphogenetic Protein 5, MGC34244) (MaxLight 650)

Sign In for Pricing
View Details
SLC44A1 discontinued
531749-01 20 µL

SLC44A1 discontinued

Sign In for Pricing
View Details
SLC44A1 discontinued
531749-02 100 µL

SLC44A1 discontinued

Sign In for Pricing
View Details
Dihydrokainic acid
MF-0095944-01 1 mg

Dihydrokainic acid

Sign In for Pricing
View Details
Dihydrokainic acid
MF-0095944-02 5 mg

Dihydrokainic acid

Sign In for Pricing
View Details
Dihydrokainic acid
MF-0095944-03 10 mg

Dihydrokainic acid

Sign In for Pricing
View Details