Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene Weinreb AM Resin
H10060.5G 5 g

Polystyrene Weinreb AM Resin

Sign In for Pricing
View Details
Axygen Microcentrifuge tubes 1.7mL
MCT-175-C-S 2500 / PCK

Axygen Microcentrifuge tubes 1.7mL

Sign In for Pricing
View Details
Wdr83 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7565404 1.0 µg DNA

Wdr83 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recoverin (RCVRN) Human shRNA Lentiviral Particle (Locus ID 5957)
TL315509V 500 µL Each

Recoverin (RCVRN) Human shRNA Lentiviral Particle (Locus ID 5957)

Sign In for Pricing
View Details
M-PEG3-amido-C3-triethoxysilane
MF-0138030-01 100 mg

M-PEG3-amido-C3-triethoxysilane

Sign In for Pricing
View Details
M-PEG3-amido-C3-triethoxysilane
MF-0138030-02 500 mg

M-PEG3-amido-C3-triethoxysilane

Sign In for Pricing
View Details