Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat GATA Binding Protein 1 ELISA Kit
MBS723626-01 48 Well

Rat GATA Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat GATA Binding Protein 1 ELISA Kit
MBS723626-02 96 Well

Rat GATA Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat GATA Binding Protein 1 ELISA Kit
MBS723626-03 5x 96 Well

Rat GATA Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Rat GATA Binding Protein 1 ELISA Kit
MBS723626-04 10x 96 Well

Rat GATA Binding Protein 1 ELISA Kit

Sign In for Pricing
View Details
Calcium/Calmodulin Dependent Protein Kinase II Alpha (CAMK2a) BioAssayTM ELISA Kit (Human)
023860 96 Tests

Calcium/Calmodulin Dependent Protein Kinase II Alpha (CAMK2a) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Recombinant Shigella Boydii def Protein (aa 1-169) (strain Sb227)
VAng-Lsx09080-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Boydii def Protein (aa 1-169) (strain Sb227)

Sign In for Pricing
View Details