Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2al2c (NM_001177569) Mouse Tagged ORF Clone
MR219667 10 µg

H2al2c (NM_001177569) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Abcf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6942106 1.0 µg DNA

Abcf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
PPIP5K2 sgRNA CRISPR Lentivector (Human) (Target 3)
K2794404 1.0 µg DNA

PPIP5K2 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cnot4 sgRNA CRISPR Lentivector set (Mouse)
K4792901 3x 1.0 µg

Cnot4 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
LOC690415 3'UTR GFP Stable Cell Line
TU262114 1.0 mL

LOC690415 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Polyclonal Antibody to CD200 Receptor 1 (CD200R1)
MBS2139814-01 0.1 mL

Polyclonal Antibody to CD200 Receptor 1 (CD200R1)

Sign In for Pricing
View Details