Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sp8 3'UTR Luciferase Stable Cell Line
TU119506 1.0 mL

Sp8 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Human C6orf52 qPCR Primer Pair
QH74069S 200 Tests

Human C6orf52 qPCR Primer Pair

Sign In for Pricing
View Details
NUDT10 Mouse Monoclonal Antibody [Clone ID: OTI1F1]
TA803813 100 µL

NUDT10 Mouse Monoclonal Antibody [Clone ID: OTI1F1]

Sign In for Pricing
View Details
CLSPN Protein Vector (Mouse) (pPM-C-His)
PV166421 500 ng

CLSPN Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Rabbit Polyclonal MAGEA10 Antibody [Alexa Fluor 594]
NBP3-06272AF594 0.1 mL

Rabbit Polyclonal MAGEA10 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
Bovine Vascular Endothelial cell Growth Factor B, VEGF-B ELISA Kit
MBS1602443-01 48 Well

Bovine Vascular Endothelial cell Growth Factor B, VEGF-B ELISA Kit

Sign In for Pricing
View Details