Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flt3 Mouse siRNA Oligo Duplex (Locus ID 14255)
SR421647 1 Kit

Flt3 Mouse siRNA Oligo Duplex (Locus ID 14255)

Sign In for Pricing
View Details
HPLC Column, C8-Low PH,5μm,120Å,3.0x50mm
13011426 1 PC

HPLC Column, C8-Low PH,5μm,120Å,3.0x50mm

Sign In for Pricing
View Details
Cdr2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K4585403 1.0 µg DNA

Cdr2 sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Mouse Elastase 2A (ELA2A) ELISA Kit
EKU03844 96 Tests

Mouse Elastase 2A (ELA2A) ELISA Kit

Sign In for Pricing
View Details
Human GPRASP2 Knockout HEK293T cell line
GTR15420836 1 Vial

Human GPRASP2 Knockout HEK293T cell line

Sign In for Pricing
View Details
TMEM164 Adenovirus (Human)
46928051 1.0 mL

TMEM164 Adenovirus (Human)

Sign In for Pricing
View Details