Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTN1 (Alpha-actinin-1, Alpha-actinin Cytoskeletal Isoform, Non-muscle alpha-actinin-1, F-actin Cross-linking Protein) (AP) discontinued
122930-AP 100 µL

ACTN1 (Alpha-actinin-1, Alpha-actinin Cytoskeletal Isoform, Non-muscle alpha-actinin-1, F-actin Cross-linking Protein) (AP) discontinued

Sign In for Pricing
View Details
Mercaptosuccinic acid
GK8337-250g 250 g

Mercaptosuccinic acid

Sign In for Pricing
View Details
Rsrc1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4101004 1.0 µg DNA

Rsrc1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
1-Butyl-5- (morpholine-4-sulfonyl) -1H-benzoimidazole-2-thiol
sc-333836 250 mg

1-Butyl-5- (morpholine-4-sulfonyl) -1H-benzoimidazole-2-thiol

Sign In for Pricing
View Details
AdmiRa-mmu-mir-6382 Virus
mm1020 250 µL

AdmiRa-mmu-mir-6382 Virus

Sign In for Pricing
View Details
Mouse Apmap (NM_027977) AAV Particle
MR206555A1V 250 µL

Mouse Apmap (NM_027977) AAV Particle

Sign In for Pricing
View Details