Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collagen 1 alpha 1 polyclonal antibody
BS67771-01 50 µL

Collagen 1 alpha 1 polyclonal antibody

Sign In for Pricing
View Details
Collagen 1 alpha 1 polyclonal antibody
BS67771-02 100 µL

Collagen 1 alpha 1 polyclonal antibody

Sign In for Pricing
View Details
TBC1D3P1 3'UTR GFP Stable Cell Line
TU075194 1.0 mL

TBC1D3P1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mtmr11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4949507 1.0 µg DNA

Mtmr11 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Human Class E basic helix loop helix protein 41 (BHLHE41) ELISA Kit
MBS7248096-01 48 Well

Human Class E basic helix loop helix protein 41 (BHLHE41) ELISA Kit

Sign In for Pricing
View Details
Human Class E basic helix loop helix protein 41 (BHLHE41) ELISA Kit
MBS7248096-02 96 Well

Human Class E basic helix loop helix protein 41 (BHLHE41) ELISA Kit

Sign In for Pricing
View Details