Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUMO2, SUMO3, NT (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (MaxLight 550) discontinued
S8026-01E-ML550 100 µL

SUMO2, SUMO3, NT (SUMO2/3, Small Ubiquitin-like Modifier 2, Small Ubiquitin-related Modifier 2, Sumo 2, Sumo-2, Small Ubiquitin-like Modifier Protein 3, Small Ubiquitin-related Modifier 3, Sumo 3, Sumo-3, HSMT3, MGC117191, Sentrin 2, Sentrin-2, SMT3 Homolog 1, SMT3 (yeast) Homolog 1, SMT3H1, SMT3 Suppressor of Mif Two 3 Homolog 2, Suppressor of Mif Two 3 Homolog 2, SMT3 Homolog 2, SMT3 (yeast) Homolog 2, SMT3H2, SMT3 Suppressor of Mif Two 3 Homolog 3, Suppressor of Mif Two 3 Homolog 3, SMT3A, SMT3B, Ubiquitin-like Protein SMT3A, Ubiquitin-like Protein SMT3B) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Anti-LRRC19 Rabbit pAb
GB115104-100 100 μL

Anti-LRRC19 Rabbit pAb

Sign In for Pricing
View Details
COG8 ORF Vector (Human) (pORF)
ORF002532 1.0 µg DNA

COG8 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
MAP3K13, CT (S869) (MAP3K13, LZK, Mitogen-activated protein kinase kinase kinase 13, Leucine zipper-bearing kinase, Mixed lineage kinase) (Azide free) (HRP) discontinued
038142-HRP 200 µL

MAP3K13, CT (S869) (MAP3K13, LZK, Mitogen-activated protein kinase kinase kinase 13, Leucine zipper-bearing kinase, Mixed lineage kinase) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
SLC1A2 AAV Vector (Human) (CMV)
43923101 1 µg

SLC1A2 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Wright-Giemsa Solution
M1438-1000 1000 mL

Wright-Giemsa Solution

Sign In for Pricing
View Details