Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAS41 (YEATS4) (NM_006530) Human Recombinant Protein
TP301526L 1 mg

GAS41 (YEATS4) (NM_006530) Human Recombinant Protein

Sign In for Pricing
View Details
Fumonisin B1
TRC-F862750-5MG 5 mg

Fumonisin B1

Sign In for Pricing
View Details
GENLISA Beta-1,3-glucanase (Beta-1,3-GA) Assay Kit
KBCA1171 96 Tests

GENLISA Beta-1,3-glucanase (Beta-1,3-GA) Assay Kit

Sign In for Pricing
View Details
Rabbit Polyclonal ASAH1 Antibody [Alexa Fluor 488]
NBP1-76933AF488 0.1 mL

Rabbit Polyclonal ASAH1 Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
Recombinant His1 virus Putative transmembrane protein ORF23 (ORF23), partial
MBS1436448-01 0.5 mg (E-Coli)

Recombinant His1 virus Putative transmembrane protein ORF23 (ORF23), partial

Sign In for Pricing
View Details
Recombinant His1 virus Putative transmembrane protein ORF23 (ORF23), partial
MBS1436448-02 0.05 mg (Baculovirus)

Recombinant His1 virus Putative transmembrane protein ORF23 (ORF23), partial

Sign In for Pricing
View Details