Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLASP2 (N-term) rat monoclonal antibody, clone KT69, Aff - Purified
AM20817PU-N 200 µg

CLASP2 (N-term) rat monoclonal antibody, clone KT69, Aff - Purified

Sign In for Pricing
View Details
TEKT4 polyclonal antibody
BS79205-01 50 µL

TEKT4 polyclonal antibody

Sign In for Pricing
View Details
TEKT4 polyclonal antibody
BS79205-02 100 µL

TEKT4 polyclonal antibody

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) AROA Polyclonal Antibody
MBS7176724 Inquire

Rabbit anti-Escherichia coli O127:H6 (strain E2348/69/EPEC) AROA Polyclonal Antibody

Sign In for Pricing
View Details
BZRP (Translocator Protein, Peripheral-type Benzodiazepine Receptor, PBR, PKBS, Mitochondrial Benzodiazepine Receptor, MBR, TSPO) (MaxLight 750) discontinued
124056-ML750 100 µL

BZRP (Translocator Protein, Peripheral-type Benzodiazepine Receptor, PBR, PKBS, Mitochondrial Benzodiazepine Receptor, MBR, TSPO) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Quick-cfDNA/cfRNA Binding Buffer, 150mL
R1072-2-150 150 mL

Quick-cfDNA/cfRNA Binding Buffer, 150mL

Sign In for Pricing
View Details