Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLASP2 Protein Vector (Human) (pPM-C-HA)
PV009611 500 ng

CLASP2 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Rab 11B (m) : 293T Lysate
sc-122878 100 µg - 200 µL

Rab 11B (m) : 293T Lysate

Sign In for Pricing
View Details
Atp5g2 (Atp5mc2) (NM_133556) Rat Tagged ORF Clone Lentiviral Particle
RR202995L3V 200 µL

Atp5g2 (Atp5mc2) (NM_133556) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CD95 (FAS) (NM_152876) Human Tagged Lenti ORF Clone
RC211839L3 10 µg

CD95 (FAS) (NM_152876) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
E. coli 0157:H7 antibody (HRP)
60-E07 100 ug

E. coli 0157:H7 antibody (HRP)

Sign In for Pricing
View Details
STBD1 siRNA (Mouse)
MBS8225952-01 15 nmol

STBD1 siRNA (Mouse)

Sign In for Pricing
View Details