Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRKAG2 Polyclonal Antibody, HRP Conjugated
bs-9446R-HRP 100 µL

PRKAG2 Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Polyclonal MYBPC2 Antibody (C-Terminus)
APR17490G 0.05mg

Polyclonal MYBPC2 Antibody (C-Terminus)

Sign In for Pricing
View Details
[D-Pro4,D-Trp7,9,10] Substance P (4-11)
MBS5825145 Inquire

[D-Pro4,D-Trp7,9,10] Substance P (4-11)

Sign In for Pricing
View Details
Dtna (NM_001285810) Mouse Tagged ORF Clone
MR230880 10 µg

Dtna (NM_001285810) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Venezuelan Equine Encephalitis Virus-Like PaRoom Temperatureicles (VEE VLPs)
VLP-035YF 1 Vial

Venezuelan Equine Encephalitis Virus-Like PaRoom Temperatureicles (VEE VLPs)

Sign In for Pricing
View Details
MMP16 Human shRNA Plasmid Kit (Locus ID 4325)
TR303232 1 Kit

MMP16 Human shRNA Plasmid Kit (Locus ID 4325)

Sign In for Pricing
View Details