Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RANKL/TNFSF11, Mouse (CHO, His)

RANKL/TNFSF11 Protein, Mouse (CHO) is a TNF-related activation-induced cytokine produced in CHO. Mouse and human RANK Ligand share 85% amino acid identity. RANK L/TNFSF11 Protein, Mouse (CHO, His) induces the activation of the c-jun N terminal kinase, enhances T cell growth and dendritic cell function, induces osteoclastogenesis, and lymph node organogenesis.

Product Specifications

Product Name Alternative

RANKL/TNFSF11 Protein, Mouse (CHO, His), Mouse, CHO

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rankl-tnfsf11-protein-mouse-cho-his.html

Purity

95.0

Smiles

RAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID

Molecular Formula

21943 (Gene_ID) O35235-1 (R72-D316) (Accession)

Molecular Weight

Approximately 34.5 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Laminin subunit beta-1 (LAMB1) ELISA Kit
EIA07866m 1 Kit

Mouse Laminin subunit beta-1 (LAMB1) ELISA Kit

Sign In for Pricing
View Details
Appbp2 Mouse siRNA Oligo Duplex (Locus ID 66884)
SR417782 1 Kit

Appbp2 Mouse siRNA Oligo Duplex (Locus ID 66884)

Sign In for Pricing
View Details
Mmu-miR-6929-5p mimic
HY-R03581-01 5 nmol

Mmu-miR-6929-5p mimic

Sign In for Pricing
View Details
Mmu-miR-6929-5p mimic
HY-R03581-02 20 nmol

Mmu-miR-6929-5p mimic

Sign In for Pricing
View Details
Tspan10 sgRNA CRISPR Lentivector set (Mouse)
K3610301 3x 1.0 µg

Tspan10 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Recombinant Salmonella heidelberg UPF0250 protein ybeD (ybeD)
MBS1187351-01 0.02 mg (E-Coli)

Recombinant Salmonella heidelberg UPF0250 protein ybeD (ybeD)

Sign In for Pricing
View Details