Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF164, Mouse

VEGF164 Protein, Mouse is a potent mediator of angiogenesis and binds the semaphorin receptor, neuropilin1.

Product Specifications

Product Name Alternative

VEGF164 Protein, Mouse, Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf165-protein-mouse.html

Purity

98.0

Smiles

MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

22339 (Gene_ID) Q00731-2 (A27-R190) (Accession)

Molecular Weight

Approximately 20 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Usui T, et al. VEGF164 (165) as the pathological isoform: differential leukocyte and endothelial responses through VEGFR1 and VEGFR2. Invest Ophthalmol Vis Sci. 2004 Feb;45 (2) :368-74.|[2]Ishida S, et al. VEGF164 is proinflammatory in the diabetic retina. Invest Ophthalmol Vis Sci. 2003 May;44 (5) :2155-62.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NKAIN2 (aa 114-150) polyclonal antibody
DPABH-22897 80 µl

Anti-NKAIN2 (aa 114-150) polyclonal antibody

Sign In for Pricing
View Details
Recombinant Human Zinc Finger and BTB Domain-Containing Protein 9/ZBTB9 Protein (C-6His)
E53A05987 50 µg

Recombinant Human Zinc Finger and BTB Domain-Containing Protein 9/ZBTB9 Protein (C-6His)

Sign In for Pricing
View Details
CACNB2 3'UTR GFP Stable Cell Line
TU053369 1.0 mL

CACNB2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
VPS35 Blocking Peptide
MBS9621497-01 1 mg

VPS35 Blocking Peptide

Sign In for Pricing
View Details
VPS35 Blocking Peptide
MBS9621497-02 5x 1 mg

VPS35 Blocking Peptide

Sign In for Pricing
View Details
Antide
4005-1000 1 mg

Antide

Sign In for Pricing
View Details