Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Matrix metalloproteinase-9 (MMP9)

Product Specifications

Product Name Alternative

MMP-9;92 kDa gelatinase;92 kDa type IV collagenase; Gelatinase B; GELB

Abbreviation

Recombinant Bovine MMP9 protein

Gene Name

MMP9

UniProt

P52176

Expression Region

107-712aa

Organism

Bos taurus (Bovine)

Target Sequence

FQTFEGELKWHHHNITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYGPEADIVIQFGVREHGDGYPFDGKNGLLAHAFPPGKGIQGDAHFDDEELWSLGKGVVIPTYFGNAKGAACHFPFTFEGRSYSACTTDGRSDDMLWCSTTADYDADRQFGFCPSERLYTQDGNADGKPCVFPFTFQGRTYSACTSDGRSDGYRWCATTANYDQDKLYGFCPTRVDATVTGGNAAGELCVFPFTFLGKEYSACTREGRNDGHLWCATTSNFDKDKKWGFCPDQGYSLFLVAAHEFGHALGLDHTSVPEALMYPMYRFTEEHPLHRDDVQGIQHLYGPRPEPEPRPPTTTTTTTTEPQPTAPPTVCVTGPPTARPSEGPTTGPTGPPAAGPTGPPTAGPSAAPTESPDPAEDVCNVDIFDAIAEIRNRLHFFKAGKYWRLSEGGGRRVQGPFLVKSKWPALPRKLDSAFEDPLTKKIFFFSGRQVWVYTGASLLGPRRLDKLGLGPEVAQVTGALPRPEGKVLLFSGQSFWRFDVKTQKVDPQSVTPVDQMFPGVPISTHDIFQYQEKAYFCQDHFYWRVSSQNEVNQVDYVGYVTFDLLKCPED

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

Yeast

Field of Research

Cancer

Relevance

Matrix metalloproteinase that plays an essential role in local proteolysis of the extracellular matrix and in leukocyte migration. Could play a role in bone osteoclastic resorption. Cleaves KiSS1 at a Gly-|-Leu bond. Cleaves NINJ1 to generate the Secreted ninjurin-1 form. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments. Degrades fibronectin but not laminin or Pz-peptide.

Endotoxin

Not test

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

68.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP60 (LK1), CF568 conjugate, 0.1mg/mL
BNC680851-500 1x 500 µL

HSP60 (LK1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL
BNC470266-500 1x 500 µL

Human IgG Immunoglobulin (IG266), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-500 1x 500 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF740 conjugate, 0.1mg/mL
BNC740861-500 1x 500 µL

HSP27 (G3.1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF555 conjugate, 0.1mg/mL
BNC551052-500 1x 500 µL

CD3e (B-B12), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details