Question 1

What is the catalog number for HSF2 Protein Vector (Mouse) (pPM-C-His)?

Accepted Answer

The catalog number for HSF2 Protein Vector (Mouse) (pPM-C-His) is PV190077.

Question 2

Is HSF2 Protein Vector (Mouse) (pPM-C-His) in stock?

Accepted Answer

HSF2 Protein Vector (Mouse) (pPM-C-His) is currently made to order / not held in immediate stock. Contact us for lead time.

Question 3

Does this product need any special customs documentation to be imported to my country?

Accepted Answer

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

Question 4

What buffer is this product supplied in?

Accepted Answer

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

Question 5

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

Accepted Answer

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

HSF2 Protein Vector (Mouse) (pPM-C-His)

Product Specifications

Frequently Asked Questions

Explore Other Products

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW TFA

Lentiviral mouse Scamp5 shRNA (UAS) - Lentiviral mouse Scamp5 shRNA (UAS, GFP) (100)

NNMT Antibody

NNMT Antibody

NNMT Antibody